Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 249138..249750 | Replicon | chromosome |
| Accession | NZ_CP116707 | ||
| Organism | Streptococcus agalactiae strain A909 sCas9revertant | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8G2N8L3 |
| Locus tag | POF62_RS01445 | Protein ID | WP_000384860.1 |
| Coordinates | 249138..249473 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | POF62_RS01450 | Protein ID | WP_000259017.1 |
| Coordinates | 249463..249750 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| POF62_RS01420 (POF62_01420) | 244336..244977 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| POF62_RS01425 (POF62_01425) | 245277..246152 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| POF62_RS01430 (POF62_01430) | 246188..246622 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| POF62_RS01435 (POF62_01435) | 246939..248195 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
| POF62_RS01440 (POF62_01440) | 248363..248833 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| POF62_RS01445 (POF62_01445) | 249138..249473 | - | 336 | WP_000384860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| POF62_RS01450 (POF62_01450) | 249463..249750 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| POF62_RS01455 (POF62_01455) | 250257..250547 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| POF62_RS01460 (POF62_01460) | 250649..251056 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| POF62_RS01465 (POF62_01465) | 251056..251616 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| POF62_RS01470 (POF62_01470) | 251589..252269 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| POF62_RS01475 (POF62_01475) | 252254..252640 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| POF62_RS01480 (POF62_01480) | 252674..252955 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| POF62_RS01485 (POF62_01485) | 253798..254658 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13227.87 Da Isoelectric Point: 4.5348
>T269144 WP_000384860.1 NZ_CP116707:c249473-249138 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|