Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 300463..301253 | Replicon | plasmid pAtA47a_a |
| Accession | NZ_CP116702 | ||
| Organism | Agrobacterium fabacearum strain A47a | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1S7NFF1 |
| Locus tag | G6M09_RS24170 | Protein ID | WP_019565755.1 |
| Coordinates | 300756..301253 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
| Locus tag | G6M09_RS24165 | Protein ID | WP_019565754.1 |
| Coordinates | 300463..300759 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6M09_RS24145 (G6M09_024145) | 295831..297555 | + | 1725 | WP_019565751.1 | ABC transporter ATP-binding protein | - |
| G6M09_RS24150 (G6M09_024150) | 297600..298787 | + | 1188 | WP_145166916.1 | galactarate dehydratase | - |
| G6M09_RS24155 (G6M09_024155) | 298774..299640 | + | 867 | WP_145166983.1 | aldose 1-epimerase | - |
| G6M09_RS24160 (G6M09_024160) | 299850..300280 | + | 431 | Protein_297 | DDE-type integrase/transposase/recombinase | - |
| G6M09_RS24165 (G6M09_024165) | 300463..300759 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
| G6M09_RS24170 (G6M09_024170) | 300756..301253 | + | 498 | WP_019565755.1 | GNAT family N-acetyltransferase | Toxin |
| G6M09_RS24175 (G6M09_024175) | 301872..302420 | + | 549 | WP_019565757.1 | TRAP transporter small permease subunit | - |
| G6M09_RS24180 (G6M09_024180) | 302438..303943 | + | 1506 | WP_173995354.1 | TRAP transporter large permease subunit | - |
| G6M09_RS24185 (G6M09_024185) | 304007..305119 | + | 1113 | WP_065703185.1 | TRAP transporter substrate-binding protein | - |
| G6M09_RS24190 (G6M09_024190) | 305183..305815 | - | 633 | WP_173995355.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..565096 | 565096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17725.27 Da Isoelectric Point: 6.8629
>T269142 WP_019565755.1 NZ_CP116702:300756-301253 [Agrobacterium fabacearum]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S7NFF1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S7NER6 |