Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 287857..288527 | Replicon | plasmid pAtA47a_a |
| Accession | NZ_CP116702 | ||
| Organism | Agrobacterium fabacearum strain A47a | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | G6M09_RS24110 | Protein ID | WP_003517201.1 |
| Coordinates | 288108..288527 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7U5CZ71 |
| Locus tag | G6M09_RS24105 | Protein ID | WP_038496682.1 |
| Coordinates | 287857..288111 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6M09_RS24095 (G6M09_024095) | 285327..286334 | + | 1008 | WP_173995352.1 | sensor histidine kinase | - |
| G6M09_RS24100 (G6M09_024100) | 286868..287473 | - | 606 | WP_065662894.1 | J domain-containing protein | - |
| G6M09_RS24105 (G6M09_024105) | 287857..288111 | + | 255 | WP_038496682.1 | plasmid stabilization protein | Antitoxin |
| G6M09_RS24110 (G6M09_024110) | 288108..288527 | + | 420 | WP_003517201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| G6M09_RS24115 (G6M09_024115) | 288747..289643 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
| G6M09_RS24120 (G6M09_024120) | 289676..290557 | - | 882 | WP_145166914.1 | SMP-30/gluconolactonase/LRE family protein | - |
| G6M09_RS24125 (G6M09_024125) | 290613..291332 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..565096 | 565096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15036.22 Da Isoelectric Point: 5.1532
>T269141 WP_003517201.1 NZ_CP116702:288108-288527 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|