Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 174199..174779 Replicon plasmid pAtA47a_a
Accession NZ_CP116702
Organism Agrobacterium fabacearum strain A47a

Toxin (Protein)


Gene name vapC Uniprot ID A0A1V2AF39
Locus tag G6M09_RS23545 Protein ID WP_060642074.1
Coordinates 174199..174582 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID F0LFX8
Locus tag G6M09_RS23550 Protein ID WP_013637280.1
Coordinates 174579..174779 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6M09_RS23520 (G6M09_023520) 170336..171004 - 669 WP_025591213.1 GntR family transcriptional regulator -
G6M09_RS23525 (G6M09_023525) 171088..171708 + 621 WP_173995475.1 C39 family peptidase -
G6M09_RS23530 (G6M09_023530) 171754..172821 + 1068 WP_019565647.1 D-alanine--D-alanine ligase family protein -
G6M09_RS23535 (G6M09_023535) 173010..173273 + 264 WP_013637284.1 hypothetical protein -
G6M09_RS23540 (G6M09_023540) 173285..173983 + 699 WP_003519101.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
G6M09_RS23545 (G6M09_023545) 174199..174582 - 384 WP_060642074.1 type II toxin-antitoxin system VapC family toxin Toxin
G6M09_RS23550 (G6M09_023550) 174579..174779 - 201 WP_013637280.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
G6M09_RS23555 (G6M09_023555) 175179..175982 - 804 WP_060642075.1 helix-turn-helix transcriptional regulator -
G6M09_RS23560 (G6M09_023560) 176057..176998 + 942 WP_060642076.1 NmrA family NAD(P)-binding protein -
G6M09_RS23565 (G6M09_023565) 177187..178218 - 1032 WP_019565654.1 ankyrin repeat domain-containing protein -
G6M09_RS23570 (G6M09_023570) 178240..179250 - 1011 WP_127966499.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..565096 565096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14271.40 Da        Isoelectric Point: 7.0613

>T269140 WP_060642074.1 NZ_CP116702:c174582-174199 [Agrobacterium fabacearum]
VILVDTSIWINHFRYDDSELRKIINDDQLLCHPFVVGELALGSLRERAAVLEFLAAQREALIATHAEVMTIIDRHSIFSM
GIGYTDAHLLTSTLLDRRSSLWTRDKRLAAAAQKVGVALYTHAQASR

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7197.28 Da        Isoelectric Point: 10.7407

>AT269140 WP_013637280.1 NZ_CP116702:c174779-174579 [Agrobacterium fabacearum]
MRSTINIDDNLMERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGSMPEAEASPRRRSDVAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V2AF39

Antitoxin

Source ID Structure
AlphaFold DB F0LFX8

References