Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 499573..500120 | Replicon | plasmid pAtCG920 |
| Accession | NZ_CP116698 | ||
| Organism | Agrobacterium fabacearum strain CG920 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | G6L96_RS26370 | Protein ID | WP_174012706.1 |
| Coordinates | 499573..499866 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | G6L96_RS26375 | Protein ID | WP_174012705.1 |
| Coordinates | 499866..500120 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L96_RS26355 (G6L96_026355) | 495349..496281 | + | 933 | WP_174012708.1 | alpha/beta hydrolase | - |
| G6L96_RS26360 (G6L96_026360) | 496346..497164 | + | 819 | WP_212509295.1 | SDR family oxidoreductase | - |
| G6L96_RS26365 (G6L96_026365) | 497513..498532 | + | 1020 | WP_174012707.1 | alpha/beta hydrolase | - |
| G6L96_RS26370 (G6L96_026370) | 499573..499866 | - | 294 | WP_174012706.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L96_RS26375 (G6L96_026375) | 499866..500120 | - | 255 | WP_174012705.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| G6L96_RS26380 (G6L96_026380) | 500456..500752 | + | 297 | WP_174012994.1 | type II toxin-antitoxin system HigB family toxin | - |
| G6L96_RS26385 (G6L96_026385) | 500752..501147 | + | 396 | WP_097099154.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| G6L96_RS26390 (G6L96_026390) | 501197..501454 | + | 258 | WP_174012695.1 | hypothetical protein | - |
| G6L96_RS26395 (G6L96_026395) | 501594..501857 | + | 264 | Protein_480 | IS6 family transposase | - |
| G6L96_RS26400 (G6L96_026400) | 501867..503237 | - | 1371 | WP_174012694.1 | PLP-dependent aminotransferase family protein | - |
| G6L96_RS26405 (G6L96_026405) | 503498..503980 | + | 483 | WP_174012693.1 | MSMEG_0572 family nitrogen starvation response protein | - |
| G6L96_RS26410 (G6L96_026410) | 504049..505038 | + | 990 | WP_112961636.1 | Nit6803 family nitriliase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..719769 | 719769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11133.79 Da Isoelectric Point: 5.8932
>T269136 WP_174012706.1 NZ_CP116698:c499866-499573 [Agrobacterium fabacearum]
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLELIATNPKMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FIIRIRHGHEDWAGDSF
MPFSLSVQAEEDIISIAEEGIRIFGALVARQYHDELFALLELIATNPKMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FIIRIRHGHEDWAGDSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|