Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 167137..167927 | Replicon | plasmid pAtCG920 |
| Accession | NZ_CP116698 | ||
| Organism | Agrobacterium fabacearum strain CG920 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | G6L96_RS24820 | Protein ID | WP_174012795.1 |
| Coordinates | 167430..167927 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
| Locus tag | G6L96_RS24815 | Protein ID | WP_019565754.1 |
| Coordinates | 167137..167433 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L96_RS24795 (G6L96_024795) | 162505..164229 | + | 1725 | WP_174012794.1 | ABC transporter ATP-binding protein | - |
| G6L96_RS24800 (G6L96_024800) | 164274..165461 | + | 1188 | WP_065662740.1 | galactarate dehydratase | - |
| G6L96_RS24805 (G6L96_024805) | 165448..166314 | + | 867 | WP_025591536.1 | aldose 1-epimerase | - |
| G6L96_RS24810 (G6L96_024810) | 166524..166954 | + | 431 | Protein_163 | DDE-type integrase/transposase/recombinase | - |
| G6L96_RS24815 (G6L96_024815) | 167137..167433 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
| G6L96_RS24820 (G6L96_024820) | 167430..167927 | + | 498 | WP_174012795.1 | GNAT family N-acetyltransferase | Toxin |
| G6L96_RS24825 (G6L96_024825) | 168207..168872 | - | 666 | WP_141194222.1 | GNAT family N-acetyltransferase | - |
| G6L96_RS24830 (G6L96_024830) | 168838..169998 | - | 1161 | WP_174012796.1 | Gfo/Idh/MocA family oxidoreductase | - |
| G6L96_RS24835 (G6L96_024835) | 170030..171280 | - | 1251 | WP_174012797.1 | ROK family protein | - |
| G6L96_RS24840 (G6L96_024840) | 171493..172452 | + | 960 | WP_174012798.1 | extracellular solute-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..719769 | 719769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17739.30 Da Isoelectric Point: 6.8629
>T269135 WP_174012795.1 NZ_CP116698:167430-167927 [Agrobacterium fabacearum]
VTLSAPIPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPIPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|