Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 154610..155280 | Replicon | plasmid pAtCG920 |
Accession | NZ_CP116698 | ||
Organism | Agrobacterium fabacearum strain CG920 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | G6L96_RS24760 | Protein ID | WP_003517201.1 |
Coordinates | 154861..155280 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | F0LGD9 |
Locus tag | G6L96_RS24755 | Protein ID | WP_003517203.1 |
Coordinates | 154610..154864 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L96_RS24745 (G6L96_024745) | 151905..152912 | + | 1008 | WP_019565741.1 | sensor histidine kinase | - |
G6L96_RS24750 (G6L96_024750) | 153622..154227 | - | 606 | WP_174012923.1 | J domain-containing protein | - |
G6L96_RS24755 (G6L96_024755) | 154610..154864 | + | 255 | WP_003517203.1 | plasmid stabilization protein | Antitoxin |
G6L96_RS24760 (G6L96_024760) | 154861..155280 | + | 420 | WP_003517201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
G6L96_RS24765 (G6L96_024765) | 155420..156316 | - | 897 | WP_112361150.1 | dihydrodipicolinate synthase family protein | - |
G6L96_RS24770 (G6L96_024770) | 156349..157230 | - | 882 | WP_174012793.1 | SMP-30/gluconolactonase/LRE family protein | - |
G6L96_RS24775 (G6L96_024775) | 157287..158006 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
G6L96_RS24780 (G6L96_024780) | 158306..160255 | + | 1950 | WP_112361153.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..719769 | 719769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15036.22 Da Isoelectric Point: 5.1532
>T269134 WP_003517201.1 NZ_CP116698:154861-155280 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|