Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2017306..2017886 | Replicon | chromosome |
Accession | NZ_CP116689 | ||
Organism | Agrobacterium tumefaciens strain LMG 292 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | G6L31_RS22655 | Protein ID | WP_080827689.1 |
Coordinates | 2017306..2017689 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | G6L31_RS22660 | Protein ID | WP_173988395.1 |
Coordinates | 2017686..2017886 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L31_RS22640 (G6L31_022640) | 2013507..2014385 | - | 879 | WP_173988398.1 | LysR substrate-binding domain-containing protein | - |
G6L31_RS22645 (G6L31_022645) | 2014520..2015677 | + | 1158 | WP_173988397.1 | class C beta-lactamase | - |
G6L31_RS22650 (G6L31_022650) | 2015935..2017257 | + | 1323 | WP_173988396.1 | solute carrier family 23 protein | - |
G6L31_RS22655 (G6L31_022655) | 2017306..2017689 | - | 384 | WP_080827689.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
G6L31_RS22660 (G6L31_022660) | 2017686..2017886 | - | 201 | WP_173988395.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
G6L31_RS22665 (G6L31_022665) | 2017998..2018630 | - | 633 | WP_173988394.1 | TetR/AcrR family transcriptional regulator | - |
G6L31_RS22670 (G6L31_022670) | 2018719..2019492 | + | 774 | WP_173988393.1 | SDR family oxidoreductase | - |
G6L31_RS22675 (G6L31_022675) | 2019749..2020234 | - | 486 | WP_173988392.1 | cupin domain-containing protein | - |
G6L31_RS22680 (G6L31_022680) | 2020325..2021566 | - | 1242 | WP_173988390.1 | Zn-dependent hydrolase | - |
G6L31_RS22685 (G6L31_022685) | 2021580..2022422 | - | 843 | WP_173988388.1 | BtpA/SgcQ family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14382.52 Da Isoelectric Point: 6.7552
>T269128 WP_080827689.1 NZ_CP116689:c2017689-2017306 [Agrobacterium tumefaciens]
VILVDTSVWIDHFRQRNVELREIIENDRLLCHPFIIGELALGSLRDREAVIGFLQAQRETVVATHDEVMTFIDRYSIFSM
GIGYTDAHLLASTLLDRRVSLWTRDKRLLAAAQKAGASVHMAASNPH
VILVDTSVWIDHFRQRNVELREIIENDRLLCHPFIIGELALGSLRDREAVIGFLQAQRETVVATHDEVMTFIDRYSIFSM
GIGYTDAHLLASTLLDRRVSLWTRDKRLLAAAQKAGASVHMAASNPH
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|