Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2098016..2098616 | Replicon | chromosome |
Accession | NZ_CP116688 | ||
Organism | Agrobacterium tumefaciens strain LMG 292 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | G6L31_RS10380 | Protein ID | WP_173987675.1 |
Coordinates | 2098016..2098303 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | G6L31_RS10385 | Protein ID | WP_080824403.1 |
Coordinates | 2098311..2098616 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L31_RS10355 (G6L31_010355) | 2093830..2094723 | - | 894 | WP_173987562.1 | hemin ABC transporter substrate-binding protein | - |
G6L31_RS10360 (G6L31_010360) | 2094910..2095257 | + | 348 | WP_006314959.1 | antibiotic biosynthesis monooxygenase | - |
G6L31_RS10365 (G6L31_010365) | 2095268..2095792 | + | 525 | WP_080827222.1 | heme utilization cystosolic carrier protein HutX | - |
G6L31_RS10370 (G6L31_010370) | 2096080..2096856 | + | 777 | WP_173987563.1 | YbaY family lipoprotein | - |
G6L31_RS10375 (G6L31_010375) | 2097078..2097962 | + | 885 | WP_173987564.1 | formyltetrahydrofolate deformylase | - |
G6L31_RS10380 (G6L31_010380) | 2098016..2098303 | + | 288 | WP_173987675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G6L31_RS10385 (G6L31_010385) | 2098311..2098616 | + | 306 | WP_080824403.1 | putative addiction module antidote protein | Antitoxin |
G6L31_RS10390 (G6L31_010390) | 2098629..2100023 | - | 1395 | WP_173987565.1 | sensor histidine kinase | - |
G6L31_RS10395 (G6L31_010395) | 2100020..2100700 | - | 681 | WP_010972345.1 | response regulator transcription factor | - |
G6L31_RS10400 (G6L31_010400) | 2100771..2101850 | + | 1080 | WP_173987677.1 | ABC transporter substrate-binding protein | - |
G6L31_RS10405 (G6L31_010405) | 2102105..2103049 | + | 945 | WP_020809150.1 | tripartite tricarboxylate transporter substrate binding protein | - |
G6L31_RS10410 (G6L31_010410) | 2103046..2103540 | + | 495 | WP_173987566.1 | tripartite tricarboxylate transporter TctB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10613.18 Da Isoelectric Point: 10.3359
>T269127 WP_173987675.1 NZ_CP116688:2098016-2098303 [Agrobacterium tumefaciens]
IRETNEFADWLAGLRDVQARARIARRIYRLADGNPGDVKPVGEGVSELRIDLGPGYRVYFVRQGDVVIILLCGGDKSSQS
RDIAKARRMARALKE
IRETNEFADWLAGLRDVQARARIARRIYRLADGNPGDVKPVGEGVSELRIDLGPGYRVYFVRQGDVVIILLCGGDKSSQS
RDIAKARRMARALKE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|