Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1888736..1889228 | Replicon | chromosome |
| Accession | NZ_CP116688 | ||
| Organism | Agrobacterium tumefaciens strain LMG 292 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | G6L31_RS09340 | Protein ID | WP_080824563.1 |
| Coordinates | 1888959..1889228 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | G6L31_RS09335 | Protein ID | WP_080824564.1 |
| Coordinates | 1888736..1888978 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L31_RS09315 (G6L31_009315) | 1883981..1884973 | + | 993 | WP_173987480.1 | glutathione S-transferase family protein | - |
| G6L31_RS09320 (G6L31_009320) | 1884990..1885481 | - | 492 | WP_173987381.1 | NUDIX domain-containing protein | - |
| G6L31_RS09325 (G6L31_009325) | 1885548..1886498 | + | 951 | WP_173987382.1 | metallophosphoesterase | - |
| G6L31_RS09330 (G6L31_009330) | 1886708..1888417 | - | 1710 | WP_173987383.1 | 2-isopropylmalate synthase | - |
| G6L31_RS09335 (G6L31_009335) | 1888736..1888978 | - | 243 | WP_080824564.1 | CopG family antitoxin | Antitoxin |
| G6L31_RS09340 (G6L31_009340) | 1888959..1889228 | - | 270 | WP_080824563.1 | BrnT family toxin | Toxin |
| G6L31_RS09345 (G6L31_009345) | 1889263..1890441 | - | 1179 | WP_173987384.1 | benzoate/H(+) symporter BenE family transporter | - |
| G6L31_RS09350 (G6L31_009350) | 1890525..1891169 | - | 645 | WP_173987385.1 | NrsF family protein | - |
| G6L31_RS09355 (G6L31_009355) | 1891166..1891681 | - | 516 | WP_233284193.1 | sigma-70 family RNA polymerase sigma factor | - |
| G6L31_RS09360 (G6L31_009360) | 1891900..1892157 | + | 258 | WP_173987386.1 | pentapeptide MXKDX repeat protein | - |
| G6L31_RS09365 (G6L31_009365) | 1892255..1892836 | - | 582 | WP_080824559.1 | ATP-dependent Clp protease proteolytic subunit | - |
| G6L31_RS09370 (G6L31_009370) | 1893069..1893659 | + | 591 | WP_173987387.1 | HupE/UreJ family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10798.24 Da Isoelectric Point: 9.4618
>T269126 WP_080824563.1 NZ_CP116688:c1889228-1888959 [Agrobacterium tumefaciens]
MDFEFDPAKSESNKDKHGIDFVEARALWLDKKRLVVPLETTSEERYIMIAQLRGKCWSAVYTYRNDRLRIISVRRSRDKE
KQRYEDDQR
MDFEFDPAKSESNKDKHGIDFVEARALWLDKKRLVVPLETTSEERYIMIAQLRGKCWSAVYTYRNDRLRIISVRRSRDKE
KQRYEDDQR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|