Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 574511..575118 | Replicon | chromosome |
Accession | NZ_CP116688 | ||
Organism | Agrobacterium tumefaciens strain LMG 292 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | G6L31_RS02845 | Protein ID | WP_173986510.1 |
Coordinates | 574511..574846 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | G6L31_RS02850 | Protein ID | WP_173986511.1 |
Coordinates | 574843..575118 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L31_RS02830 (G6L31_002830) | 570554..572743 | - | 2190 | WP_173986508.1 | transglycosylase domain-containing protein | - |
G6L31_RS02835 (G6L31_002835) | 572999..573490 | + | 492 | WP_173986558.1 | YcgN family cysteine cluster protein | - |
G6L31_RS02840 (G6L31_002840) | 573659..574483 | + | 825 | WP_173986509.1 | class D beta-lactamase | - |
G6L31_RS02845 (G6L31_002845) | 574511..574846 | - | 336 | WP_173986510.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
G6L31_RS02850 (G6L31_002850) | 574843..575118 | - | 276 | WP_173986511.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
G6L31_RS02855 (G6L31_002855) | 575327..577909 | + | 2583 | WP_173986512.1 | heavy metal translocating P-type ATPase | - |
G6L31_RS02860 (G6L31_002860) | 577906..578328 | + | 423 | WP_173986513.1 | Cu(I)-responsive transcriptional regulator | - |
G6L31_RS02865 (G6L31_002865) | 578380..578580 | + | 201 | WP_173986514.1 | heavy-metal-associated domain-containing protein | - |
G6L31_RS02870 (G6L31_002870) | 578657..578926 | + | 270 | WP_173986515.1 | type II toxin-antitoxin system ParD family antitoxin | - |
G6L31_RS02875 (G6L31_002875) | 578916..579275 | + | 360 | WP_173986516.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
G6L31_RS02880 (G6L31_002880) | 579272..579520 | - | 249 | WP_173986517.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12934.81 Da Isoelectric Point: 9.6009
>T269125 WP_173986510.1 NZ_CP116688:c574846-574511 [Agrobacterium tumefaciens]
VTDKKGHGKDAAAKRTVLPRSSDFTKQFIKDWQRLNNSGRYDMVKLKEIMLLLIANEAPLPAQFRDHELTGEWHDHRECH
VGGNFLLIYKLDEKQNFLIFTRAGTHAELFR
VTDKKGHGKDAAAKRTVLPRSSDFTKQFIKDWQRLNNSGRYDMVKLKEIMLLLIANEAPLPAQFRDHELTGEWHDHRECH
VGGNFLLIYKLDEKQNFLIFTRAGTHAELFR
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|