Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 330969..331449 | Replicon | chromosome |
Accession | NZ_CP116688 | ||
Organism | Agrobacterium tumefaciens strain LMG 292 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | G6L31_RS01605 | Protein ID | WP_173986348.1 |
Coordinates | 330969..331238 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A176XG90 |
Locus tag | G6L31_RS01610 | Protein ID | WP_063947698.1 |
Coordinates | 331222..331449 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L31_RS01575 (G6L31_001575) | 326025..326804 | - | 780 | WP_173986343.1 | L,D-transpeptidase | - |
G6L31_RS01580 (G6L31_001580) | 327042..327671 | + | 630 | WP_173986344.1 | DNA-3-methyladenine glycosylase I | - |
G6L31_RS01585 (G6L31_001585) | 327668..328111 | + | 444 | WP_173986345.1 | hypothetical protein | - |
G6L31_RS01590 (G6L31_001590) | 328122..329165 | - | 1044 | WP_173986346.1 | YeiH family protein | - |
G6L31_RS01595 (G6L31_001595) | 329247..330164 | + | 918 | WP_080855993.1 | LysR family transcriptional regulator | - |
G6L31_RS01600 (G6L31_001600) | 330198..330962 | - | 765 | WP_173986347.1 | hypothetical protein | - |
G6L31_RS01605 (G6L31_001605) | 330969..331238 | - | 270 | WP_173986348.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
G6L31_RS01610 (G6L31_001610) | 331222..331449 | - | 228 | WP_063947698.1 | DUF6290 family protein | Antitoxin |
G6L31_RS01615 (G6L31_001615) | 331606..333147 | + | 1542 | WP_173986349.1 | histidine--tRNA ligase | - |
G6L31_RS01620 (G6L31_001620) | 333316..334443 | + | 1128 | WP_080825891.1 | ATP phosphoribosyltransferase regulatory subunit | - |
G6L31_RS01625 (G6L31_001625) | 334440..335132 | + | 693 | WP_080825889.1 | ATP phosphoribosyltransferase | - |
G6L31_RS01630 (G6L31_001630) | 335191..335637 | - | 447 | WP_080825888.1 | DoxX family protein | - |
G6L31_RS01635 (G6L31_001635) | 335793..336227 | - | 435 | WP_080825887.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10729.39 Da Isoelectric Point: 9.8259
>T269124 WP_173986348.1 NZ_CP116688:c331238-330969 [Agrobacterium tumefaciens]
VIWTIEYHTLVQKEMRKINPEVRRRIRSFLHERLAALDDPRQTGAALQGSELGNYWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
VIWTIEYHTLVQKEMRKINPEVRRRIRSFLHERLAALDDPRQTGAALQGSELGNYWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|