Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB-HicA |
Location | 93526..94147 | Replicon | chromosome |
Accession | NZ_CP116688 | ||
Organism | Agrobacterium tumefaciens strain LMG 292 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | G6L31_RS00450 | Protein ID | WP_173986218.1 |
Coordinates | 93959..94147 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | G6L31_RS00445 | Protein ID | WP_080826623.1 |
Coordinates | 93526..93954 (-) | Length | 143 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L31_RS00420 (G6L31_000420) | 88952..91123 | + | 2172 | WP_236772994.1 | TonB-dependent siderophore receptor | - |
G6L31_RS00425 (G6L31_000425) | 91233..92114 | + | 882 | WP_173986186.1 | AraC family transcriptional regulator | - |
G6L31_RS00430 (G6L31_000430) | 92244..92636 | + | 393 | WP_035214685.1 | PRC-barrel domain-containing protein | - |
G6L31_RS00435 (G6L31_000435) | 92730..92972 | - | 243 | WP_080826626.1 | DUF982 domain-containing protein | - |
G6L31_RS00440 (G6L31_000440) | 93290..93448 | - | 159 | WP_020811433.1 | YqaE/Pmp3 family membrane protein | - |
G6L31_RS00445 (G6L31_000445) | 93526..93954 | - | 429 | WP_080826623.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
G6L31_RS00450 (G6L31_000450) | 93959..94147 | - | 189 | WP_173986218.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
G6L31_RS00460 (G6L31_000460) | 94532..95494 | - | 963 | WP_173986187.1 | nitronate monooxygenase family protein | - |
G6L31_RS00465 (G6L31_000465) | 95749..96897 | + | 1149 | WP_173986188.1 | hypothetical protein | - |
G6L31_RS00470 (G6L31_000470) | 96946..97827 | - | 882 | WP_173986189.1 | polyphosphate kinase 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6908.01 Da Isoelectric Point: 11.1572
>T269123 WP_173986218.1 NZ_CP116688:c94147-93959 [Agrobacterium tumefaciens]
MKSGDIISALKADGWYEVGTRGSHVQFKHPTKQGRVTVPHPRRDLPIGTLKSIEKQSGLKLR
MKSGDIISALKADGWYEVGTRGSHVQFKHPTKQGRVTVPHPRRDLPIGTLKSIEKQSGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15421.23 Da Isoelectric Point: 4.2241
>AT269123 WP_080826623.1 NZ_CP116688:c93954-93526 [Agrobacterium tumefaciens]
MRNYIGLIHKDADSDYGVSFPDFPGVITAGTDLDDARHMAEEALALHVEGMIEDGEAIPEPSSLETVMADAENKDGVAIL
VTLKTESKKSVRINITLPEDVLKAIDAFAEARGLTRSGFLARAAKHEMSSVSEDDDWREFAA
MRNYIGLIHKDADSDYGVSFPDFPGVITAGTDLDDARHMAEEALALHVEGMIEDGEAIPEPSSLETVMADAENKDGVAIL
VTLKTESKKSVRINITLPEDVLKAIDAFAEARGLTRSGFLARAAKHEMSSVSEDDDWREFAA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|