Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4814566..4815152 | Replicon | chromosome |
Accession | NZ_CP116682 | ||
Organism | Pseudomonas aeruginosa strain HS337 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | OK431_RS22830 | Protein ID | WP_003120987.1 |
Coordinates | 4814853..4815152 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OK431_RS22825 | Protein ID | WP_003448662.1 |
Coordinates | 4814566..4814856 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK431_RS22805 (OK431_22790) | 4810142..4812037 | + | 1896 | WP_234493604.1 | hypothetical protein | - |
OK431_RS22810 (OK431_22795) | 4812034..4814010 | + | 1977 | WP_042931628.1 | DEAD/DEAH box helicase | - |
OK431_RS22815 (OK431_22800) | 4814020..4814154 | + | 135 | WP_033179080.1 | hypothetical protein | - |
OK431_RS22820 (OK431_22805) | 4814151..4814495 | + | 345 | WP_003448665.1 | hypothetical protein | - |
OK431_RS22825 (OK431_22810) | 4814566..4814856 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
OK431_RS22830 (OK431_22815) | 4814853..4815152 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OK431_RS22835 (OK431_22820) | 4815354..4816475 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
OK431_RS22840 (OK431_22825) | 4816475..4818184 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
OK431_RS22845 (OK431_22830) | 4818188..4819513 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
OK431_RS22850 (OK431_22835) | 4819503..4820036 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4783323..4870689 | 87366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T269117 WP_003120987.1 NZ_CP116682:c4815152-4814853 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|