Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2539570..2540086 | Replicon | chromosome |
| Accession | NZ_CP116682 | ||
| Organism | Pseudomonas aeruginosa strain HS337 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | OK431_RS12330 | Protein ID | WP_025297453.1 |
| Coordinates | 2539805..2540086 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | OK431_RS12325 | Protein ID | WP_025297454.1 |
| Coordinates | 2539570..2539815 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK431_RS12310 (OK431_12305) | 2535348..2537549 | - | 2202 | WP_033976850.1 | hypothetical protein | - |
| OK431_RS12315 (OK431_12310) | 2537647..2538723 | - | 1077 | WP_052156709.1 | WYL domain-containing protein | - |
| OK431_RS12320 (OK431_12315) | 2538881..2539135 | - | 255 | WP_153574174.1 | hypothetical protein | - |
| OK431_RS12325 (OK431_12320) | 2539570..2539815 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| OK431_RS12330 (OK431_12325) | 2539805..2540086 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OK431_RS12335 (OK431_12330) | 2540492..2541073 | - | 582 | WP_033976848.1 | plasmid pRiA4b ORF-3 family protein | - |
| OK431_RS12340 (OK431_12335) | 2541087..2541962 | - | 876 | WP_033976847.1 | WYL domain-containing protein | - |
| OK431_RS12345 (OK431_12340) | 2542092..2543672 | + | 1581 | WP_070147860.1 | DNA recombination protein RmuC | - |
| OK431_RS12350 (OK431_12345) | 2543696..2544343 | + | 648 | WP_033976844.1 | peptidase M15 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2528010..2571255 | 43245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T269114 WP_025297453.1 NZ_CP116682:2539805-2540086 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |