Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 160105..160610 | Replicon | chromosome |
| Accession | NZ_CP116682 | ||
| Organism | Pseudomonas aeruginosa strain HS337 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | OK431_RS00740 | Protein ID | WP_003083773.1 |
| Coordinates | 160105..160386 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | OK431_RS00745 | Protein ID | WP_003083775.1 |
| Coordinates | 160383..160610 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK431_RS00715 (OK431_00715) | 155356..156705 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| OK431_RS00720 (OK431_00720) | 156754..157440 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| OK431_RS00725 (OK431_00725) | 157541..158275 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| OK431_RS00730 (OK431_00730) | 158455..158865 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| OK431_RS00735 (OK431_00735) | 158897..159805 | - | 909 | WP_010793581.1 | LysR family transcriptional regulator | - |
| OK431_RS00740 (OK431_00740) | 160105..160386 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| OK431_RS00745 (OK431_00745) | 160383..160610 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OK431_RS00750 (OK431_00750) | 160786..161406 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| OK431_RS00755 (OK431_00755) | 161507..162007 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| OK431_RS00760 (OK431_00760) | 162080..162421 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| OK431_RS00765 (OK431_00765) | 162503..163930 | - | 1428 | WP_003083784.1 | GABA permease | - |
| OK431_RS00770 (OK431_00770) | 164099..165592 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T269111 WP_003083773.1 NZ_CP116682:c160386-160105 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|