Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 2762..3350 | Replicon | plasmid pCanadaBC5-8.7 |
Accession | NZ_CP116681 | ||
Organism | Acinetobacter baumannii Canada BC-5 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
Locus tag | POF49_RS19340 | Protein ID | WP_000438826.1 |
Coordinates | 2762..3049 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | POF49_RS19345 | Protein ID | WP_001983304.1 |
Coordinates | 3036..3350 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
POF49_RS19320 (POF49_19320) | 1..951 | + | 951 | WP_001205343.1 | replication initiation protein RepM | - |
POF49_RS19325 (POF49_19325) | 944..1519 | + | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
POF49_RS19330 (POF49_19330) | 1539..1682 | + | 144 | WP_001125246.1 | hypothetical protein | - |
POF49_RS19335 (POF49_19335) | 1871..2389 | - | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
POF49_RS19340 (POF49_19340) | 2762..3049 | + | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
POF49_RS19345 (POF49_19345) | 3036..3350 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
POF49_RS19350 (POF49_19350) | 3478..5889 | + | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
POF49_RS19355 (POF49_19355) | 6194..6655 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
POF49_RS19360 (POF49_19360) | 6978..7151 | - | 174 | WP_001282484.1 | hypothetical protein | - |
POF49_RS19365 (POF49_19365) | 7151..7522 | - | 372 | WP_000504218.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..8731 | 8731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T269110 WP_000438826.1 NZ_CP116681:2762-3049 [Acinetobacter baumannii Canada BC-5]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |