Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 111390..111967 | Replicon | plasmid pEtSC002-3 |
Accession | NZ_CP116678 | ||
Organism | Edwardsiella tarda strain SC002 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PHA77_RS18800 | Protein ID | WP_279509954.1 |
Coordinates | 111635..111967 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PHA77_RS18795 | Protein ID | WP_279509953.1 |
Coordinates | 111390..111635 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA77_RS18770 (PHA77_18770) | 106444..107403 | - | 960 | WP_279509948.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PHA77_RS18775 (PHA77_18775) | 107711..109225 | + | 1515 | Protein_107 | IS21 family transposase | - |
PHA77_RS18780 (PHA77_18780) | 109249..110004 | + | 756 | WP_279509949.1 | IS21-like element helper ATPase IstB | - |
PHA77_RS18785 (PHA77_18785) | 110338..110607 | + | 270 | WP_279509951.1 | hypothetical protein | - |
PHA77_RS18790 (PHA77_18790) | 110595..111224 | + | 630 | WP_279509952.1 | hypothetical protein | - |
PHA77_RS18795 (PHA77_18795) | 111390..111635 | + | 246 | WP_279509953.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PHA77_RS18800 (PHA77_18800) | 111635..111967 | + | 333 | WP_279509954.1 | endoribonuclease MazF | Toxin |
PHA77_RS18805 (PHA77_18805) | 112091..112741 | - | 651 | Protein_113 | IS630 family transposase | - |
PHA77_RS18810 (PHA77_18810) | 112844..113518 | + | 675 | Protein_114 | IS21 family transposase | - |
PHA77_RS18815 (PHA77_18815) | 113743..114966 | + | 1224 | WP_279509955.1 | IS91 family transposase | - |
PHA77_RS18820 (PHA77_18820) | 115518..116501 | - | 984 | WP_068872129.1 | ParB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..154848 | 154848 | |
- | inside | IScluster/Tn | - | - | 107929..113338 | 5409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11957.89 Da Isoelectric Point: 8.2674
>T269108 WP_279509954.1 NZ_CP116678:111635-111967 [Edwardsiella tarda]
MVSRFVPDSGDLIWIDFDPVAGHEQGGKRPAVVLSPFAYNNKVGLLLCVPCTTKVKNYPFEVELSGERDSVALADQITCV
DWRARKVTKKGAISAIELADIRAKAKALIG
MVSRFVPDSGDLIWIDFDPVAGHEQGGKRPAVVLSPFAYNNKVGLLLCVPCTTKVKNYPFEVELSGERDSVALADQITCV
DWRARKVTKKGAISAIELADIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|