Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 48796..49421 | Replicon | plasmid pEtSC002-3 |
Accession | NZ_CP116678 | ||
Organism | Edwardsiella tarda strain SC002 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PHA77_RS18505 | Protein ID | WP_279509900.1 |
Coordinates | 49023..49421 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PHA77_RS18500 | Protein ID | WP_279509898.1 |
Coordinates | 48796..49023 (+) | Length | 76 a.a. |
Genomic Context
Location: 48796..49023 (228 bp)
Type: Antitoxin
Protein ID: WP_279509898.1
Type: Antitoxin
Protein ID: WP_279509898.1
Location: 49023..49421 (399 bp)
Type: Toxin
Protein ID: WP_279509900.1
Type: Toxin
Protein ID: WP_279509900.1
Location: 49499..51703 (2205 bp)
Type: Others
Protein ID: WP_279509902.1
Type: Others
Protein ID: WP_279509902.1
Location: 51790..52287 (498 bp)
Type: Others
Protein ID: WP_279509904.1
Type: Others
Protein ID: WP_279509904.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA77_RS18500 (PHA77_18500) | 48796..49023 | + | 228 | WP_279509898.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PHA77_RS18505 (PHA77_18505) | 49023..49421 | + | 399 | WP_279509900.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PHA77_RS18510 (PHA77_18510) | 49499..51703 | - | 2205 | WP_279509902.1 | type IV conjugative transfer system coupling protein TraD | - |
PHA77_RS18515 (PHA77_18515) | 51790..52287 | - | 498 | WP_279509904.1 | conjugal transfer protein TraS | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..154848 | 154848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14831.13 Da Isoelectric Point: 8.5070
>T269107 WP_279509900.1 NZ_CP116678:49023-49421 [Edwardsiella tarda]
MLKYMLDTNICIFTLKNRPAQVREKFNLHHNQMCISAITLMELIYGAEKSQAPERNLAVIEGVIARLTVLNYDVPAAAHS
GQLRAEQARQGQPIGPYDQMIAGHARSQGLILVTNNTREFARVSGLRIEDWV
MLKYMLDTNICIFTLKNRPAQVREKFNLHHNQMCISAITLMELIYGAEKSQAPERNLAVIEGVIARLTVLNYDVPAAAHS
GQLRAEQARQGQPIGPYDQMIAGHARSQGLILVTNNTREFARVSGLRIEDWV
Download Length: 399 bp