Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 41337..41890 | Replicon | plasmid pEtSC002-3 |
Accession | NZ_CP116678 | ||
Organism | Edwardsiella tarda strain SC002 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PHA77_RS18475 | Protein ID | WP_279509893.1 |
Coordinates | 41337..41651 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PHA77_RS18480 | Protein ID | WP_279509894.1 |
Coordinates | 41654..41890 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA77_RS18455 (PHA77_18455) | 36425..36649 | - | 225 | Protein_43 | IS66 family insertion sequence element accessory protein TnpB | - |
PHA77_RS18460 (PHA77_18460) | 37035..37982 | - | 948 | WP_279509889.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PHA77_RS18465 (PHA77_18465) | 38944..39861 | - | 918 | WP_279509971.1 | Replication protein | - |
PHA77_RS18470 (PHA77_18470) | 40593..41024 | - | 432 | WP_279509892.1 | hypothetical protein | - |
PHA77_RS18475 (PHA77_18475) | 41337..41651 | - | 315 | WP_279509893.1 | CcdB family protein | Toxin |
PHA77_RS18480 (PHA77_18480) | 41654..41890 | - | 237 | WP_279509894.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PHA77_RS18485 (PHA77_18485) | 42002..42622 | - | 621 | WP_279509895.1 | fertility inhibition protein FinO | - |
PHA77_RS18490 (PHA77_18490) | 42636..43361 | - | 726 | WP_141112577.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..154848 | 154848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11620.64 Da Isoelectric Point: 7.9859
>T269106 WP_279509893.1 NZ_CP116678:c41651-41337 [Edwardsiella tarda]
MQFTVYRNIGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPGSARPERLVPLVRLTDDKEYAVMTHEMASIPARSLG
GVFCDASLYRTQIKAAIDFLLDGI
MQFTVYRNIGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPGSARPERLVPLVRLTDDKEYAVMTHEMASIPARSLG
GVFCDASLYRTQIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|