269105

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 35548..36191 Replicon plasmid pEtSC002-1
Accession NZ_CP116676
Organism Edwardsiella tarda strain SC002

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag PHA77_RS17225 Protein ID WP_000754566.1
Coordinates 35775..36191 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag PHA77_RS17220 Protein ID WP_001261276.1
Coordinates 35548..35778 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA77_RS17185 (PHA77_17185) 31163..31255 + 93 Protein_33 DUF4113 domain-containing protein -
PHA77_RS17190 (PHA77_17190) 31432..32070 + 639 WP_279509759.1 AAA family ATPase -
PHA77_RS17195 (PHA77_17195) 32070..32363 + 294 WP_279509760.1 CopG family transcriptional regulator -
PHA77_RS17200 (PHA77_17200) 32486..33286 - 801 WP_279509762.1 site-specific integrase -
PHA77_RS17205 (PHA77_17205) 33283..33906 - 624 WP_279509763.1 DUF2913 family protein -
PHA77_RS17210 (PHA77_17210) 34016..34957 - 942 WP_279509764.1 hypothetical protein -
PHA77_RS17215 (PHA77_17215) 35322..35591 - 270 Protein_39 hypothetical protein -
PHA77_RS17220 (PHA77_17220) 35548..35778 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PHA77_RS17225 (PHA77_17225) 35775..36191 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
PHA77_RS17230 (PHA77_17230) 36272..36976 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
PHA77_RS17235 (PHA77_17235) 37028..37264 - 237 Protein_43 recombinase family protein -
PHA77_RS17240 (PHA77_17240) 37428..38315 + 888 Protein_44 DUF4158 domain-containing protein -
PHA77_RS17245 (PHA77_17245) 38369..39073 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PHA77_RS17250 (PHA77_17250) 39137..39466 + 330 Protein_46 recombinase family protein -
PHA77_RS17255 (PHA77_17255) 39649..40509 + 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / qnrS1 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..114035 114035


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T269105 WP_000754566.1 NZ_CP116676:35775-36191 [Edwardsiella tarda]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT269105 WP_001261276.1 NZ_CP116676:35548-35778 [Edwardsiella tarda]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References