Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 35548..36191 | Replicon | plasmid pEtSC002-1 |
| Accession | NZ_CP116676 | ||
| Organism | Edwardsiella tarda strain SC002 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | PHA77_RS17225 | Protein ID | WP_000754566.1 |
| Coordinates | 35775..36191 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | PHA77_RS17220 | Protein ID | WP_001261276.1 |
| Coordinates | 35548..35778 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA77_RS17185 (PHA77_17185) | 31163..31255 | + | 93 | Protein_33 | DUF4113 domain-containing protein | - |
| PHA77_RS17190 (PHA77_17190) | 31432..32070 | + | 639 | WP_279509759.1 | AAA family ATPase | - |
| PHA77_RS17195 (PHA77_17195) | 32070..32363 | + | 294 | WP_279509760.1 | CopG family transcriptional regulator | - |
| PHA77_RS17200 (PHA77_17200) | 32486..33286 | - | 801 | WP_279509762.1 | site-specific integrase | - |
| PHA77_RS17205 (PHA77_17205) | 33283..33906 | - | 624 | WP_279509763.1 | DUF2913 family protein | - |
| PHA77_RS17210 (PHA77_17210) | 34016..34957 | - | 942 | WP_279509764.1 | hypothetical protein | - |
| PHA77_RS17215 (PHA77_17215) | 35322..35591 | - | 270 | Protein_39 | hypothetical protein | - |
| PHA77_RS17220 (PHA77_17220) | 35548..35778 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PHA77_RS17225 (PHA77_17225) | 35775..36191 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PHA77_RS17230 (PHA77_17230) | 36272..36976 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PHA77_RS17235 (PHA77_17235) | 37028..37264 | - | 237 | Protein_43 | recombinase family protein | - |
| PHA77_RS17240 (PHA77_17240) | 37428..38315 | + | 888 | Protein_44 | DUF4158 domain-containing protein | - |
| PHA77_RS17245 (PHA77_17245) | 38369..39073 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PHA77_RS17250 (PHA77_17250) | 39137..39466 | + | 330 | Protein_46 | recombinase family protein | - |
| PHA77_RS17255 (PHA77_17255) | 39649..40509 | + | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B / qnrS1 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..114035 | 114035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T269105 WP_000754566.1 NZ_CP116676:35775-36191 [Edwardsiella tarda]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |