Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2576382..2576974 | Replicon | chromosome |
| Accession | NZ_CP116675 | ||
| Organism | Edwardsiella tarda strain SC002 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D4F316 |
| Locus tag | PHA77_RS12035 | Protein ID | WP_005283517.1 |
| Coordinates | 2576771..2576974 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | D4F317 |
| Locus tag | PHA77_RS12030 | Protein ID | WP_005283520.1 |
| Coordinates | 2576382..2576750 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA77_RS12020 (PHA77_12020) | 2571624..2572808 | + | 1185 | WP_005296656.1 | efflux RND transporter periplasmic adaptor subunit | - |
| PHA77_RS12025 (PHA77_12025) | 2572853..2576008 | + | 3156 | WP_005283526.1 | efflux RND transporter permease subunit | - |
| PHA77_RS12030 (PHA77_12030) | 2576382..2576750 | + | 369 | WP_005283520.1 | Hha toxicity modulator TomB | Antitoxin |
| PHA77_RS12035 (PHA77_12035) | 2576771..2576974 | + | 204 | WP_005283517.1 | HHA domain-containing protein | Toxin |
| PHA77_RS12045 (PHA77_12045) | 2577927..2578250 | + | 324 | WP_068869962.1 | MGMT family protein | - |
| PHA77_RS12050 (PHA77_12050) | 2578331..2579197 | + | 867 | WP_068869964.1 | acyl-CoA thioesterase II | - |
| PHA77_RS12055 (PHA77_12055) | 2579222..2580499 | - | 1278 | WP_035594812.1 | ammonium transporter AmtB | - |
| PHA77_RS12060 (PHA77_12060) | 2580526..2580864 | - | 339 | WP_035594810.1 | P-II family nitrogen regulator | - |
| PHA77_RS12065 (PHA77_12065) | 2581144..2581605 | - | 462 | WP_005296844.1 | Lrp/AsnC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8088.36 Da Isoelectric Point: 5.8288
>T269104 WP_005283517.1 NZ_CP116675:2576771-2576974 [Edwardsiella tarda]
MTKIDYLMKLRKCTSLETLERVIEKNKYELSNDELEVFYSAADHRLAELTMNKLYDKIPAEVWQYVR
MTKIDYLMKLRKCTSLETLERVIEKNKYELSNDELEVFYSAADHRLAELTMNKLYDKIPAEVWQYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14260.05 Da Isoelectric Point: 6.0582
>AT269104 WP_005283520.1 NZ_CP116675:2576382-2576750 [Edwardsiella tarda]
MDEYTSYRHDIAELKYLCDSLYRQGMDVLEESHHGWVSDPTAMVNLQLNELIEHIANVALSFKIKYPQHSSLCEIVDDYL
DETYALFSAYSVSEQALRHWLRSKRRVAYSLAHEKRNAALHV
MDEYTSYRHDIAELKYLCDSLYRQGMDVLEESHHGWVSDPTAMVNLQLNELIEHIANVALSFKIKYPQHSSLCEIVDDYL
DETYALFSAYSVSEQALRHWLRSKRRVAYSLAHEKRNAALHV
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|