Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 563175..563844 | Replicon | chromosome |
| Accession | NZ_CP116675 | ||
| Organism | Edwardsiella tarda strain SC002 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2A7U6Y8 |
| Locus tag | PHA77_RS02590 | Protein ID | WP_005296363.1 |
| Coordinates | 563422..563844 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A2A7U0A3 |
| Locus tag | PHA77_RS02585 | Protein ID | WP_005296359.1 |
| Coordinates | 563175..563441 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA77_RS02565 (PHA77_02565) | 558411..559061 | - | 651 | WP_077999838.1 | hemolysin III family protein | - |
| PHA77_RS02570 (PHA77_02570) | 559637..560521 | + | 885 | WP_279509088.1 | nucleoside-specific channel-forming protein Tsx | - |
| PHA77_RS02575 (PHA77_02575) | 560731..561555 | + | 825 | WP_097364355.1 | shikimate 5-dehydrogenase | - |
| PHA77_RS02580 (PHA77_02580) | 561608..562603 | - | 996 | WP_279509090.1 | tRNA-modifying protein YgfZ | - |
| PHA77_RS02585 (PHA77_02585) | 563175..563441 | + | 267 | WP_005296359.1 | FAD assembly factor SdhE | Antitoxin |
| PHA77_RS02590 (PHA77_02590) | 563422..563844 | + | 423 | WP_005296363.1 | protein YgfX | Toxin |
| PHA77_RS02595 (PHA77_02595) | 563928..564446 | - | 519 | WP_005282086.1 | flavodoxin FldB | - |
| PHA77_RS02600 (PHA77_02600) | 564584..565483 | + | 900 | WP_005282082.1 | site-specific tyrosine recombinase XerD | - |
| PHA77_RS02605 (PHA77_02605) | 565511..566227 | + | 717 | WP_005282080.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PHA77_RS02610 (PHA77_02610) | 566232..567965 | + | 1734 | WP_005296366.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16231.84 Da Isoelectric Point: 9.3042
>T269097 WP_005296363.1 NZ_CP116675:563422-563844 [Edwardsiella tarda]
VAPWCCNVHVSWRTQVIALLGYGALVLTILLAPWPESYGVSAFWLLLLVVVIFECIRSQRRIARNRGELQYSATGEWRWQ
QREWRLARRPWISDMGVLLLLQSSAGPARRRRLWLAADSMSQEEWSELRALLLNAPETND
VAPWCCNVHVSWRTQVIALLGYGALVLTILLAPWPESYGVSAFWLLLLVVVIFECIRSQRRIARNRGELQYSATGEWRWQ
QREWRLARRPWISDMGVLLLLQSSAGPARRRRLWLAADSMSQEEWSELRALLLNAPETND
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A7U6Y8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A7U0A3 |