Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 3881386..3881891 | Replicon | chromosome |
| Accession | NZ_CP116672 | ||
| Organism | Xanthomonas hortorum pv. pelargonii strain 305 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | V7ZHE2 |
| Locus tag | PML25_RS16065 | Protein ID | WP_023902910.1 |
| Coordinates | 3881634..3881891 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relE | Uniprot ID | A0A6V7E8M0 |
| Locus tag | PML25_RS16060 | Protein ID | WP_043888988.1 |
| Coordinates | 3881386..3881637 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML25_RS16040 (PML25_16040) | 3876759..3877913 | - | 1155 | WP_168959477.1 | 2-methylcitrate synthase | - |
| PML25_RS16045 (PML25_16045) | 3877989..3878885 | - | 897 | WP_168959476.1 | methylisocitrate lyase | - |
| PML25_RS16050 (PML25_16050) | 3879013..3880632 | + | 1620 | WP_180336594.1 | propionate catabolism operon regulatory protein PrpR | - |
| PML25_RS16055 (PML25_16055) | 3880875..3881201 | - | 327 | WP_168959474.1 | hypothetical protein | - |
| PML25_RS16060 (PML25_16060) | 3881386..3881637 | + | 252 | WP_043888988.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PML25_RS16065 (PML25_16065) | 3881634..3881891 | + | 258 | WP_023902910.1 | Txe/YoeB family addiction module toxin | Toxin |
| PML25_RS16075 (PML25_16075) | 3882400..3882753 | - | 354 | WP_003483889.1 | PilZ domain-containing protein | - |
| PML25_RS16080 (PML25_16080) | 3882750..3883709 | - | 960 | WP_168959473.1 | DNA polymerase III subunit delta' | - |
| PML25_RS16085 (PML25_16085) | 3883706..3884767 | - | 1062 | WP_233366604.1 | endolytic transglycosylase MltG | - |
| PML25_RS16090 (PML25_16090) | 3884840..3886195 | - | 1356 | WP_168959472.1 | aminodeoxychorismate synthase component I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10170.68 Da Isoelectric Point: 9.6587
>T269093 WP_023902910.1 NZ_CP116672:3881634-3881891 [Xanthomonas hortorum pv. pelargonii]
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6V7E8N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6V7E8M0 |