Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1460656..1461434 | Replicon | chromosome |
Accession | NZ_CP116672 | ||
Organism | Xanthomonas hortorum pv. pelargonii strain 305 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | PML25_RS06065 | Protein ID | WP_168958945.1 |
Coordinates | 1460656..1461147 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | PML25_RS06070 | Protein ID | WP_168958946.1 |
Coordinates | 1461144..1461434 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML25_RS06050 (PML25_06050) | 1457239..1458159 | + | 921 | WP_168958943.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
PML25_RS06055 (PML25_06055) | 1458503..1459180 | + | 678 | WP_006448355.1 | response regulator transcription factor | - |
PML25_RS06060 (PML25_06060) | 1459173..1460507 | + | 1335 | WP_168958944.1 | HAMP domain-containing sensor histidine kinase | - |
PML25_RS06065 (PML25_06065) | 1460656..1461147 | - | 492 | WP_168958945.1 | GNAT family N-acetyltransferase | Toxin |
PML25_RS06070 (PML25_06070) | 1461144..1461434 | - | 291 | WP_168958946.1 | DUF1778 domain-containing protein | Antitoxin |
PML25_RS06075 (PML25_06075) | 1461510..1461911 | - | 402 | WP_168958947.1 | SymE family type I addiction module toxin | - |
PML25_RS06080 (PML25_06080) | 1462440..1463063 | - | 624 | WP_168958948.1 | dephospho-CoA kinase | - |
PML25_RS06085 (PML25_06085) | 1463077..1463940 | - | 864 | WP_016849610.1 | A24 family peptidase | - |
PML25_RS06090 (PML25_06090) | 1463947..1465206 | - | 1260 | WP_168958949.1 | type II secretion system F family protein | - |
PML25_RS06095 (PML25_06095) | 1465558..1465983 | + | 426 | WP_168958950.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1416869..1493280 | 76411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17592.27 Da Isoelectric Point: 9.6230
>T269091 WP_168958945.1 NZ_CP116672:c1461147-1460656 [Xanthomonas hortorum pv. pelargonii]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALVRDAGKRVLHAADTIGIRGLLVHALSTDAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACADDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALVRDAGKRVLHAADTIGIRGLLVHALSTDAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|