Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-MqsA |
| Location | 3862151..3862850 | Replicon | chromosome |
| Accession | NZ_CP116621 | ||
| Organism | Proteus terrae strain TP22 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ONR67_RS17765 | Protein ID | WP_075671320.1 |
| Coordinates | 3862151..3862537 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ONR67_RS17770 | Protein ID | WP_075671318.1 |
| Coordinates | 3862530..3862850 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR67_RS17750 (ONR67_17750) | 3858189..3858773 | - | 585 | WP_109419307.1 | DNA-3-methyladenine glycosylase I | - |
| ONR67_RS17755 (ONR67_17755) | 3859012..3859917 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
| ONR67_RS17760 (ONR67_17760) | 3859927..3861999 | + | 2073 | WP_271976618.1 | glycine--tRNA ligase subunit beta | - |
| ONR67_RS17765 (ONR67_17765) | 3862151..3862537 | + | 387 | WP_075671320.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ONR67_RS17770 (ONR67_17770) | 3862530..3862850 | + | 321 | WP_075671318.1 | helix-turn-helix domain-containing protein | Antitoxin |
| ONR67_RS17775 (ONR67_17775) | 3862918..3863238 | - | 321 | WP_196576345.1 | hypothetical protein | - |
| ONR67_RS17780 (ONR67_17780) | 3863344..3864630 | - | 1287 | WP_075671314.1 | DUF3748 domain-containing protein | - |
| ONR67_RS17785 (ONR67_17785) | 3864767..3865384 | + | 618 | WP_006534609.1 | trimeric intracellular cation channel family protein | - |
| ONR67_RS17790 (ONR67_17790) | 3865690..3866313 | + | 624 | WP_006534608.1 | guanylate kinase | - |
| ONR67_RS17795 (ONR67_17795) | 3866368..3866643 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14358.75 Da Isoelectric Point: 10.0463
>T269089 WP_075671320.1 NZ_CP116621:3862151-3862537 [Proteus terrae]
MVIYKTKMFKNSFKKMPINDAALIDIANEVYAGHFEADLGGGIIKKRICIHGKGKSSGIRTIIFYKQGSNLFFADGWKKS
HLSAKKSKEITDDELESYKDLAKDLFSATKNKIDKMVALGLLTEVKHD
MVIYKTKMFKNSFKKMPINDAALIDIANEVYAGHFEADLGGGIIKKRICIHGKGKSSGIRTIIFYKQGSNLFFADGWKKS
HLSAKKSKEITDDELESYKDLAKDLFSATKNKIDKMVALGLLTEVKHD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|