Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/GNAT-DUF1778 |
| Location | 2417949..2418694 | Replicon | chromosome |
| Accession | NZ_CP116621 | ||
| Organism | Proteus terrae strain TP22 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | ONR67_RS11395 | Protein ID | WP_075673025.1 |
| Coordinates | 2418203..2418694 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | ONR67_RS11390 | Protein ID | WP_075673024.1 |
| Coordinates | 2417949..2418215 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ONR67_RS11355 (ONR67_11355) | 2413610..2414092 | + | 483 | WP_006533151.1 | flagellar basal body-associated protein FliL | - |
| ONR67_RS11360 (ONR67_11360) | 2414098..2415129 | + | 1032 | WP_023581831.1 | flagellar motor switch protein FliM | - |
| ONR67_RS11365 (ONR67_11365) | 2415122..2415532 | + | 411 | WP_006533153.1 | flagellar motor switch protein FliN | - |
| ONR67_RS11370 (ONR67_11370) | 2415536..2415982 | + | 447 | WP_075673022.1 | flagellar biosynthetic protein FliO | - |
| ONR67_RS11375 (ONR67_11375) | 2415982..2416752 | + | 771 | WP_023581828.1 | flagellar type III secretion system pore protein FliP | - |
| ONR67_RS11380 (ONR67_11380) | 2416768..2417037 | + | 270 | WP_069367481.1 | flagellar biosynthesis protein FliQ | - |
| ONR67_RS11385 (ONR67_11385) | 2417043..2417825 | + | 783 | WP_099660619.1 | flagellar biosynthetic protein FliR | - |
| ONR67_RS11390 (ONR67_11390) | 2417949..2418215 | + | 267 | WP_075673024.1 | DUF1778 domain-containing protein | Antitoxin |
| ONR67_RS11395 (ONR67_11395) | 2418203..2418694 | + | 492 | WP_075673025.1 | GNAT family N-acetyltransferase | Toxin |
| ONR67_RS11400 (ONR67_11400) | 2418780..2419724 | - | 945 | WP_159241969.1 | flagellar hook-associated protein FlgL | - |
| ONR67_RS11405 (ONR67_11405) | 2419756..2421399 | - | 1644 | WP_159241968.1 | flagellar hook-associated protein FlgK | - |
| ONR67_RS11410 (ONR67_11410) | 2421517..2422503 | - | 987 | WP_159241967.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| ONR67_RS11415 (ONR67_11415) | 2422503..2423609 | - | 1107 | WP_075673029.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 18228.15 Da Isoelectric Point: 10.3194
>T269085 WP_075673025.1 NZ_CP116621:2418203-2418694 [Proteus terrae]
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSTQDKILFLALK
KKI
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSTQDKILFLALK
KKI
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|