Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3784071..3784770 | Replicon | chromosome |
Accession | NZ_CP116620 | ||
Organism | Proteus terrae strain CZP50 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ONR71_RS17425 | Protein ID | WP_075671320.1 |
Coordinates | 3784071..3784457 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ONR71_RS17430 | Protein ID | WP_075671318.1 |
Coordinates | 3784450..3784770 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR71_RS17410 (ONR71_17410) | 3780109..3780693 | - | 585 | WP_159242124.1 | DNA-3-methyladenine glycosylase I | - |
ONR71_RS17415 (ONR71_17415) | 3780932..3781837 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
ONR71_RS17420 (ONR71_17420) | 3781847..3783919 | + | 2073 | WP_075671322.1 | glycine--tRNA ligase subunit beta | - |
ONR71_RS17425 (ONR71_17425) | 3784071..3784457 | + | 387 | WP_075671320.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONR71_RS17430 (ONR71_17430) | 3784450..3784770 | + | 321 | WP_075671318.1 | helix-turn-helix domain-containing protein | Antitoxin |
ONR71_RS17435 (ONR71_17435) | 3784838..3785158 | - | 321 | WP_075671316.1 | hypothetical protein | - |
ONR71_RS17440 (ONR71_17440) | 3785252..3786538 | - | 1287 | WP_159242125.1 | DUF3748 domain-containing protein | - |
ONR71_RS17445 (ONR71_17445) | 3786675..3787292 | + | 618 | WP_006534609.1 | trimeric intracellular cation channel family protein | - |
ONR71_RS17450 (ONR71_17450) | 3787598..3788221 | + | 624 | WP_006534608.1 | guanylate kinase | - |
ONR71_RS17455 (ONR71_17455) | 3788276..3788551 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14358.75 Da Isoelectric Point: 10.0463
>T269083 WP_075671320.1 NZ_CP116620:3784071-3784457 [Proteus terrae]
MVIYKTKMFKNSFKKMPINDAALIDIANEVYAGHFEADLGGGIIKKRICIHGKGKSSGIRTIIFYKQGSNLFFADGWKKS
HLSAKKSKEITDDELESYKDLAKDLFSATKNKIDKMVALGLLTEVKHD
MVIYKTKMFKNSFKKMPINDAALIDIANEVYAGHFEADLGGGIIKKRICIHGKGKSSGIRTIIFYKQGSNLFFADGWKKS
HLSAKKSKEITDDELESYKDLAKDLFSATKNKIDKMVALGLLTEVKHD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|