Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/GNAT-DUF1778 |
Location | 2352997..2353742 | Replicon | chromosome |
Accession | NZ_CP116620 | ||
Organism | Proteus terrae strain CZP50 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | ONR71_RS10850 | Protein ID | WP_159241970.1 |
Coordinates | 2353251..2353742 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | ONR71_RS10845 | Protein ID | WP_075673024.1 |
Coordinates | 2352997..2353263 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONR71_RS10810 (ONR71_10810) | 2348658..2349140 | + | 483 | WP_006533151.1 | flagellar basal body-associated protein FliL | - |
ONR71_RS10815 (ONR71_10815) | 2349146..2350177 | + | 1032 | WP_023581831.1 | flagellar motor switch protein FliM | - |
ONR71_RS10820 (ONR71_10820) | 2350170..2350580 | + | 411 | WP_006533153.1 | flagellar motor switch protein FliN | - |
ONR71_RS10825 (ONR71_10825) | 2350584..2351030 | + | 447 | WP_075673022.1 | flagellar biosynthetic protein FliO | - |
ONR71_RS10830 (ONR71_10830) | 2351030..2351800 | + | 771 | WP_023581828.1 | flagellar type III secretion system pore protein FliP | - |
ONR71_RS10835 (ONR71_10835) | 2351816..2352085 | + | 270 | WP_069367481.1 | flagellar biosynthesis protein FliQ | - |
ONR71_RS10840 (ONR71_10840) | 2352091..2352873 | + | 783 | WP_099660619.1 | flagellar biosynthetic protein FliR | - |
ONR71_RS10845 (ONR71_10845) | 2352997..2353263 | + | 267 | WP_075673024.1 | DUF1778 domain-containing protein | Antitoxin |
ONR71_RS10850 (ONR71_10850) | 2353251..2353742 | + | 492 | WP_159241970.1 | GNAT family N-acetyltransferase | Toxin |
ONR71_RS10855 (ONR71_10855) | 2353828..2354772 | - | 945 | WP_159241969.1 | flagellar hook-associated protein FlgL | - |
ONR71_RS10860 (ONR71_10860) | 2354804..2356447 | - | 1644 | WP_159241968.1 | flagellar hook-associated protein FlgK | - |
ONR71_RS10865 (ONR71_10865) | 2356565..2357551 | - | 987 | WP_159241967.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
ONR71_RS10870 (ONR71_10870) | 2357551..2358657 | - | 1107 | WP_159241966.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 18240.21 Da Isoelectric Point: 10.3194
>T269079 WP_159241970.1 NZ_CP116620:2353251-2353742 [Proteus terrae]
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSIQDKILFLALK
KKI
MGKVTAPEPLSNSHEVADFYSSENVLDNWIKQRGLKNQFLGASRTFVVCEKNKKRVVGYYSLATGSVNHTEAMSHIRRNM
PDPIPVIILARLAVDKTFHGKGLGADLLRDAVLRCHHVAENIGVRAIMVHALTENAKHFYLHHGFKASSIQDKILFLALK
KKI
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|