269075

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2419987..2420605 Replicon chromosome
Accession NZ_CP116604
Organism Streptococcus sp. HN38

Toxin (Protein)


Gene name relE Uniprot ID A0A116MJ73
Locus tag PHA78_RS11890 Protein ID WP_024377605.1
Coordinates 2420264..2420605 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A116MIL6
Locus tag PHA78_RS11885 Protein ID WP_024398776.1
Coordinates 2419987..2420274 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA78_RS11855 2415769..2416038 + 270 WP_228377842.1 hypothetical protein -
PHA78_RS11860 2416279..2417202 - 924 WP_002942036.1 zinc ABC transporter substrate-binding protein -
PHA78_RS11865 2417328..2417987 + 660 WP_002942034.1 metal-dependent transcriptional regulator -
PHA78_RS11870 2418001..2418276 - 276 WP_024409693.1 hypothetical protein -
PHA78_RS11875 2418374..2419048 - 675 WP_272158227.1 type II CAAX endopeptidase family protein -
PHA78_RS11880 2419111..2419761 - 651 WP_024377607.1 type II CAAX endopeptidase family protein -
PHA78_RS11885 2419987..2420274 + 288 WP_024398776.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PHA78_RS11890 2420264..2420605 + 342 WP_024377605.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PHA78_RS11895 2420700..2420894 - 195 WP_099806881.1 hypothetical protein -
PHA78_RS11900 2420916..2421617 - 702 WP_099806880.1 type II CAAX endopeptidase family protein -
PHA78_RS11905 2421621..2421845 - 225 WP_099806879.1 hypothetical protein -
PHA78_RS11910 2421886..2422560 - 675 WP_099806878.1 type II CAAX endopeptidase family protein -
PHA78_RS11915 2422557..2422745 - 189 WP_099806891.1 hypothetical protein -
PHA78_RS11920 2422781..2422963 - 183 WP_099806877.1 hypothetical protein -
PHA78_RS11925 2423072..2423281 - 210 WP_024398780.1 hypothetical protein -
PHA78_RS11930 2423591..2423776 - 186 WP_099806876.1 hypothetical protein -
PHA78_RS11935 2423823..2423984 - 162 WP_002942006.1 hypothetical protein -
PHA78_RS11940 2424025..2424183 - 159 WP_099806875.1 bacteriocin -
PHA78_RS11945 2424433..2425047 - 615 WP_099806874.1 PBECR4 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-100)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(11-90)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13071.05 Da        Isoelectric Point: 7.1990

>T269075 WP_024377605.1 NZ_CP116604:2420264-2420605 [Streptococcus sp. HN38]
MVYEVHLSAKAEQDLEEIYQYYVREFSESSARKVLASLSTAILTLEIFPEGYIDLDARLGQALFPEGKTRMIPGKQHLIF
YLIRGSRVDVLRIRGARTDYLNNLDNLFKQTLK

Download         Length: 342 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10813.25 Da        Isoelectric Point: 4.1956

>AT269075 WP_024398776.1 NZ_CP116604:2419987-2420274 [Streptococcus sp. HN38]
MAGLVRDRQYNFRVNAQLLEQAKIILSEKDMTLSDALNLFVERVVEEQDLPIKTVEEARAEAFLDELIAELDEGYQEVLS
GHTTPAREVFAKYGL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A116MJ73

Antitoxin

Source ID Structure
AlphaFold DB A0A116MIL6

References