Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2320014..2320620 Replicon chromosome
Accession NZ_CP116604
Organism Streptococcus sp. HN38

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PHA78_RS11405 Protein ID WP_024377964.1
Coordinates 2320014..2320343 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0Z8LVV9
Locus tag PHA78_RS11410 Protein ID WP_002940311.1
Coordinates 2320333..2320620 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA78_RS11375 2315388..2316260 - 873 WP_024375781.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PHA78_RS11380 2316272..2317126 - 855 WP_024375782.1 DNA adenine methylase -
PHA78_RS11385 2317141..2318820 - 1680 WP_029876022.1 AAA family ATPase -
PHA78_RS11390 2318958..2319215 - 258 WP_024375784.1 Txe/YoeB family addiction module toxin -
PHA78_RS11395 2319217..2319477 - 261 WP_029693774.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PHA78_RS11400 2319553..2320007 - 455 Protein_2212 8-oxo-dGTP diphosphatase -
PHA78_RS11405 2320014..2320343 - 330 WP_024377964.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PHA78_RS11410 2320333..2320620 - 288 WP_002940311.1 hypothetical protein Antitoxin
PHA78_RS11415 2320718..2321086 - 369 WP_024377965.1 hypothetical protein -
PHA78_RS11420 2321079..2321648 - 570 WP_024377966.1 ribonuclease M5 -
PHA78_RS11425 2321632..2322414 - 783 WP_024377967.1 TatD family hydrolase -
PHA78_RS11430 2322521..2322658 - 138 WP_002939016.1 50S ribosomal protein L34 -
PHA78_RS11435 2322826..2323821 - 996 WP_024377968.1 RNA-binding cell elongation regulator Jag/EloR -
PHA78_RS11440 2323841..2324653 - 813 WP_024377969.1 YidC/Oxa1 family membrane protein insertase -
PHA78_RS11445 2324637..2324996 - 360 WP_024377970.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-96)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12595.52 Da        Isoelectric Point: 5.7541

>T269074 WP_024377964.1 NZ_CP116604:c2320343-2320014 [Streptococcus sp. HN38]
MEFESYSVMLAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10911.52 Da        Isoelectric Point: 4.3472

>AT269074 WP_002940311.1 NZ_CP116604:c2320620-2320333 [Streptococcus sp. HN38]
MITIKKDAQVNFKTDSRLLEKAKEIFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GQGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8LVV9

References