Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 2320014..2320620 | Replicon | chromosome |
| Accession | NZ_CP116604 | ||
| Organism | Streptococcus sp. HN38 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PHA78_RS11405 | Protein ID | WP_024377964.1 |
| Coordinates | 2320014..2320343 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0Z8LVV9 |
| Locus tag | PHA78_RS11410 | Protein ID | WP_002940311.1 |
| Coordinates | 2320333..2320620 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA78_RS11375 | 2315388..2316260 | - | 873 | WP_024375781.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| PHA78_RS11380 | 2316272..2317126 | - | 855 | WP_024375782.1 | DNA adenine methylase | - |
| PHA78_RS11385 | 2317141..2318820 | - | 1680 | WP_029876022.1 | AAA family ATPase | - |
| PHA78_RS11390 | 2318958..2319215 | - | 258 | WP_024375784.1 | Txe/YoeB family addiction module toxin | - |
| PHA78_RS11395 | 2319217..2319477 | - | 261 | WP_029693774.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PHA78_RS11400 | 2319553..2320007 | - | 455 | Protein_2212 | 8-oxo-dGTP diphosphatase | - |
| PHA78_RS11405 | 2320014..2320343 | - | 330 | WP_024377964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA78_RS11410 | 2320333..2320620 | - | 288 | WP_002940311.1 | hypothetical protein | Antitoxin |
| PHA78_RS11415 | 2320718..2321086 | - | 369 | WP_024377965.1 | hypothetical protein | - |
| PHA78_RS11420 | 2321079..2321648 | - | 570 | WP_024377966.1 | ribonuclease M5 | - |
| PHA78_RS11425 | 2321632..2322414 | - | 783 | WP_024377967.1 | TatD family hydrolase | - |
| PHA78_RS11430 | 2322521..2322658 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| PHA78_RS11435 | 2322826..2323821 | - | 996 | WP_024377968.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| PHA78_RS11440 | 2323841..2324653 | - | 813 | WP_024377969.1 | YidC/Oxa1 family membrane protein insertase | - |
| PHA78_RS11445 | 2324637..2324996 | - | 360 | WP_024377970.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12595.52 Da Isoelectric Point: 5.7541
>T269074 WP_024377964.1 NZ_CP116604:c2320343-2320014 [Streptococcus sp. HN38]
MEFESYSVMLAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK
MEFESYSVMLAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|