Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1682078..1682682 | Replicon | chromosome |
| Accession | NZ_CP116604 | ||
| Organism | Streptococcus sp. HN38 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0M9FK57 |
| Locus tag | PHA78_RS08105 | Protein ID | WP_024375895.1 |
| Coordinates | 1682078..1682269 (+) | Length | 64 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0M9FJP6 |
| Locus tag | PHA78_RS08110 | Protein ID | WP_024375896.1 |
| Coordinates | 1682305..1682682 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA78_RS08090 | 1680464..1680610 | + | 147 | Protein_1553 | AraC family transcriptional regulator | - |
| PHA78_RS08095 | 1680998..1681633 | - | 636 | Protein_1554 | site-specific integrase | - |
| PHA78_RS08100 | 1681721..1681909 | + | 189 | WP_238595224.1 | hypothetical protein | - |
| PHA78_RS08105 | 1682078..1682269 | + | 192 | WP_024375895.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PHA78_RS08110 | 1682305..1682682 | + | 378 | WP_024375896.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PHA78_RS08115 | 1683004..1685271 | - | 2268 | WP_272157956.1 | glycogen/starch/alpha-glucan phosphorylase | - |
| PHA78_RS08120 | 1685409..1686122 | - | 714 | WP_104930709.1 | purine-nucleoside phosphorylase | - |
| PHA78_RS08125 | 1686155..1686964 | - | 810 | WP_014638303.1 | purine-nucleoside phosphorylase | - |
| PHA78_RS08130 | 1686976..1687332 | - | 357 | WP_104930708.1 | ArsC/Spx/MgsR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7017.28 Da Isoelectric Point: 10.6194
>T269071 WP_024375895.1 NZ_CP116604:1682078-1682269 [Streptococcus sp. HN38]
MPLTGKEMAKLAEANGWKEIRVNGSHHHFKKEGFSKIVTIPVHGNKDLGKGLEKKILRDLGLL
MPLTGKEMAKLAEANGWKEIRVNGSHHHFKKEGFSKIVTIPVHGNKDLGKGLEKKILRDLGLL
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14195.03 Da Isoelectric Point: 4.2530
>AT269071 WP_024375896.1 NZ_CP116604:1682305-1682682 [Streptococcus sp. HN38]
MLKSYPAIFHKDEQGYWVEFPEFSGGTQGDNLEEAMYNARDFLESSIALYIDEGMELPKVSDIKELSAPDGFVSMIQADP
TPYIKNNKAIRKNVTVPEWLTKLADREGLNYSEILTTALETRLQV
MLKSYPAIFHKDEQGYWVEFPEFSGGTQGDNLEEAMYNARDFLESSIALYIDEGMELPKVSDIKELSAPDGFVSMIQADP
TPYIKNNKAIRKNVTVPEWLTKLADREGLNYSEILTTALETRLQV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M9FK57 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M9FJP6 |