Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1596640..1597309 | Replicon | chromosome |
| Accession | NZ_CP116604 | ||
| Organism | Streptococcus sp. HN38 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | G7SGM1 |
| Locus tag | PHA78_RS07600 | Protein ID | WP_014637653.1 |
| Coordinates | 1597127..1597309 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0Z8N440 |
| Locus tag | PHA78_RS07595 | Protein ID | WP_024376647.1 |
| Coordinates | 1596640..1597089 (-) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA78_RS07580 | 1592468..1594333 | - | 1866 | WP_272157926.1 | C69 family dipeptidase | - |
| PHA78_RS07585 | 1594422..1595282 | - | 861 | WP_024378591.1 | SAM-dependent methyltransferase TehB | - |
| PHA78_RS07590 | 1595436..1596479 | + | 1044 | WP_024378592.1 | Zn-dependent alcohol dehydrogenase | - |
| PHA78_RS07595 | 1596640..1597089 | - | 450 | WP_024376647.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PHA78_RS07600 | 1597127..1597309 | - | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PHA78_RS07605 | 1597474..1598040 | - | 567 | WP_024378593.1 | hypothetical protein | - |
| PHA78_RS07610 | 1598054..1598272 | - | 219 | WP_029175784.1 | hypothetical protein | - |
| PHA78_RS07615 | 1598819..1599286 | - | 468 | WP_014637647.1 | SsrA-binding protein SmpB | - |
| PHA78_RS07620 | 1599289..1601658 | - | 2370 | WP_272157927.1 | ribonuclease R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T269070 WP_014637653.1 NZ_CP116604:c1597309-1597127 [Streptococcus sp. HN38]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16620.63 Da Isoelectric Point: 4.0193
>AT269070 WP_024376647.1 NZ_CP116604:c1597089-1596640 [Streptococcus sp. HN38]
MLVTYPALFYFDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGINLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKLHA
MLVTYPALFYFDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGINLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKLHA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G7SGM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8N440 |