Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
Location | 177152..177689 | Replicon | chromosome |
Accession | NZ_CP116600 | ||
Organism | Burkholderia pseudomallei strain MSHR5089 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | AQ936_RS00700 | Protein ID | WP_009923450.1 |
Coordinates | 177420..177689 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | Q63NA3 |
Locus tag | AQ936_RS00695 | Protein ID | WP_004525420.1 |
Coordinates | 177152..177436 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AQ936_RS00665 (AQ936_000665) | 172260..173522 | - | 1263 | WP_009975402.1 | cytochrome c peroxidase | - |
AQ936_RS00670 (AQ936_000670) | 173681..175141 | - | 1461 | WP_038737257.1 | metallophosphoesterase | - |
AQ936_RS00675 (AQ936_000675) | 175388..175504 | + | 117 | Protein_134 | transposase | - |
AQ936_RS00680 (AQ936_000680) | 175731..176123 | - | 393 | Protein_135 | IS110 family transposase | - |
AQ936_RS00685 (AQ936_000685) | 176122..176505 | - | 384 | Protein_136 | integrase core domain-containing protein | - |
AQ936_RS00695 (AQ936_000695) | 177152..177436 | - | 285 | WP_004525420.1 | BrnA antitoxin family protein | Antitoxin |
AQ936_RS00700 (AQ936_000700) | 177420..177689 | - | 270 | WP_009923450.1 | BrnT family toxin | Toxin |
AQ936_RS00705 (AQ936_000705) | 178260..178535 | + | 276 | WP_004552388.1 | bacteriophage protein Gp49 | - |
AQ936_RS00710 (AQ936_000710) | 178545..178676 | + | 132 | WP_009923452.1 | bacteriophage protein Gp48 | - |
AQ936_RS00715 (AQ936_000715) | 178814..179056 | + | 243 | WP_004545584.1 | hypothetical protein | - |
AQ936_RS00720 (AQ936_000720) | 179053..179211 | + | 159 | WP_004549802.1 | hypothetical protein | - |
AQ936_RS00725 (AQ936_000725) | 179259..179477 | + | 219 | WP_004552392.1 | hypothetical protein | - |
AQ936_RS00730 (AQ936_000730) | 179663..180316 | - | 654 | WP_004545536.1 | hypothetical protein | - |
AQ936_RS00735 (AQ936_000735) | 180565..180714 | + | 150 | WP_004537646.1 | bacteriophage protein Gp44 | - |
AQ936_RS00740 (AQ936_000740) | 180750..181283 | + | 534 | Protein_146 | SPFH domain-containing protein | - |
AQ936_RS00745 (AQ936_000745) | 181482..181910 | + | 429 | Protein_147 | integrase core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 170032..197807 | 27775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10156.52 Da Isoelectric Point: 7.1633
>T269065 WP_009923450.1 NZ_CP116600:c177689-177420 [Burkholderia pseudomallei]
MDITFDPTKNKTNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDSMHIISMRKANKR
EVKSYVEQA
MDITFDPTKNKTNIAKHGVSLALAAQLDWSDVLSYVDDRRDYSEVREVGFGVIGDRLYCVVFTQRGDSMHIISMRKANKR
EVKSYVEQA
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|