269064

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1959735..1960206 Replicon chromosome
Accession NZ_CP116597
Organism Staphylococcus sp. NRL 22/194

Toxin (Protein)


Gene name TsaT Uniprot ID -
Locus tag PNR82_RS09795 Protein ID WP_243589808.1
Coordinates 1960018..1960206 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag PNR82_RS09790 Protein ID WP_243589807.1
Coordinates 1959735..1959992 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PNR82_RS09755 1954960..1955685 - 726 WP_243589800.1 type I 3-dehydroquinate dehydratase -
PNR82_RS09760 1955858..1956280 + 423 WP_243589801.1 organic hydroperoxide resistance protein -
PNR82_RS09765 1956530..1957021 + 492 WP_272106663.1 GNAT family N-acetyltransferase -
PNR82_RS09770 1957165..1957785 + 621 WP_243589803.1 LysE family transporter -
PNR82_RS09775 1957871..1958464 - 594 WP_243589804.1 histidine phosphatase family protein -
PNR82_RS09780 1958741..1958983 + 243 WP_243589805.1 hypothetical protein -
PNR82_RS09785 1958975..1959178 - 204 WP_243589806.1 sterile alpha motif-like domain-containing protein -
PNR82_RS09790 1959735..1959992 + 258 WP_243589807.1 hypothetical protein Antitoxin
PNR82_RS09795 1960018..1960206 + 189 WP_243589808.1 hypothetical protein Toxin
PNR82_RS09800 1960299..1960874 + 576 WP_272106664.1 lipoprotein N-acylation protein LnsA -
PNR82_RS09805 1960973..1961209 - 237 WP_243589810.1 hypothetical protein -
PNR82_RS09810 1961394..1962002 - 609 WP_243589811.1 GNAT family N-acetyltransferase -
PNR82_RS09815 1962148..1962894 + 747 WP_243589812.1 poly-gamma-glutamate hydrolase family protein -
PNR82_RS09820 1962986..1963273 + 288 WP_243589813.1 hypothetical protein -
PNR82_RS09825 1963333..1963554 + 222 WP_243589814.1 hypothetical protein -
PNR82_RS09830 1963710..1964546 + 837 WP_243589815.1 hypothetical protein -
PNR82_RS09835 1964713..1964889 + 177 WP_243589816.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7070.69 Da        Isoelectric Point: 9.6269

>T269064 WP_243589808.1 NZ_CP116597:1960018-1960206 [Staphylococcus sp. NRL 22/194]
MSTHLTILLWLGIFFVIAASIILGLLLKSKKDERKESYLGFTVVFYIFGFALLIYVLIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9899.97 Da        Isoelectric Point: 5.9855

>AT269064 WP_243589807.1 NZ_CP116597:1959735-1959992 [Staphylococcus sp. NRL 22/194]
MNSSKLFWFNIVMTIAFLGFNIIVTYYPKLDDFFWLIPGLIVSSVTIIISLSTATICKNLISEVIFLINIVLLLYYVYPI
IYNFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References