Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1023746..1024541 | Replicon | chromosome |
Accession | NZ_CP116597 | ||
Organism | Staphylococcus sp. NRL 22/194 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | PNR82_RS05135 | Protein ID | WP_243589016.1 |
Coordinates | 1024368..1024541 (+) | Length | 58 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PNR82_RS05130 | Protein ID | WP_243589015.1 |
Coordinates | 1023746..1024345 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PNR82_RS05110 | 1019638..1021092 | + | 1455 | WP_243589011.1 | ABC transporter substrate-binding protein/permease | - |
PNR82_RS05115 | 1021085..1021807 | + | 723 | WP_243589012.1 | amino acid ABC transporter ATP-binding protein | - |
PNR82_RS05120 | 1021968..1023094 | + | 1127 | Protein_974 | tRNA epoxyqueuosine(34) reductase QueG | - |
PNR82_RS05125 | 1023095..1023565 | + | 471 | WP_243589014.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PNR82_RS05130 | 1023746..1024345 | + | 600 | WP_243589015.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PNR82_RS05135 | 1024368..1024541 | + | 174 | WP_243589016.1 | SAS053 family protein | Toxin |
PNR82_RS05140 | 1024722..1025114 | + | 393 | WP_243589017.1 | hypothetical protein | - |
PNR82_RS05145 | 1025251..1026636 | + | 1386 | WP_243589018.1 | class II fumarate hydratase | - |
PNR82_RS05150 | 1026699..1027520 | - | 822 | WP_243603614.1 | RluA family pseudouridine synthase | - |
PNR82_RS05155 | 1027732..1028849 | + | 1118 | Protein_981 | GAF domain-containing sensor histidine kinase | - |
PNR82_RS05160 | 1028868..1029490 | + | 623 | Protein_982 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6726.17 Da Isoelectric Point: 3.9487
>T269063 WP_243589016.1 NZ_CP116597:1024368-1024541 [Staphylococcus sp. NRL 22/194]
MSDKKETELNYHEEENAMVQDLDDLKELGKEMEQISEKNDEEKLNQSHDSDVRSDLD
MSDKKETELNYHEEENAMVQDLDDLKELGKEMEQISEKNDEEKLNQSHDSDVRSDLD
Download Length: 174 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22463.45 Da Isoelectric Point: 4.8518
>AT269063 WP_243589015.1 NZ_CP116597:1023746-1024345 [Staphylococcus sp. NRL 22/194]
MAMNFKVFNDVDQVAQFTADIIRKQFNNNPTTIAGLHLERETAPVLDELKKDVDRNPVDFSQVNILDYDDNRSYYEALGV
PSGQIYPINLDDDATSLIDDKIKTKENKGKLILQVTSIDEKGSLNVNIRQGLMKAREVVLVITGGQKREFVKKLYEENGK
SSFEPADLKVHRMVTVVLDRAAAEGLPEDVKEYFTAHFA
MAMNFKVFNDVDQVAQFTADIIRKQFNNNPTTIAGLHLERETAPVLDELKKDVDRNPVDFSQVNILDYDDNRSYYEALGV
PSGQIYPINLDDDATSLIDDKIKTKENKGKLILQVTSIDEKGSLNVNIRQGLMKAREVVLVITGGQKREFVKKLYEENGK
SSFEPADLKVHRMVTVVLDRAAAEGLPEDVKEYFTAHFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|