Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 887096..887667 | Replicon | chromosome |
Accession | NZ_CP116597 | ||
Organism | Staphylococcus sp. NRL 22/194 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PNR82_RS04330 | Protein ID | WP_272108684.1 |
Coordinates | 887263..887667 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PNR82_RS04325 | Protein ID | WP_243588913.1 |
Coordinates | 887096..887266 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PNR82_RS04300 | 882914..883393 | + | 480 | WP_243588909.1 | PH domain-containing protein | - |
PNR82_RS04305 | 883386..884912 | + | 1527 | WP_243588910.1 | PH domain-containing protein | - |
PNR82_RS04310 | 884905..885399 | + | 495 | WP_243603600.1 | PH domain-containing protein | - |
PNR82_RS04315 | 885420..885779 | + | 360 | WP_243588911.1 | holo-ACP synthase | - |
PNR82_RS04320 | 885861..887009 | + | 1149 | WP_243588912.1 | alanine racemase | - |
PNR82_RS04325 | 887096..887266 | + | 171 | WP_243588913.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PNR82_RS04330 | 887263..887667 | + | 405 | WP_272108684.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PNR82_RS04335 | 887938..888939 | + | 1002 | WP_243588915.1 | PP2C family protein-serine/threonine phosphatase | - |
PNR82_RS04340 | 889031..889357 | + | 327 | WP_243588916.1 | anti-sigma factor antagonist | - |
PNR82_RS04345 | 889383..889835 | + | 453 | WP_243590233.1 | anti-sigma B factor RsbW | - |
PNR82_RS04350 | 889810..890580 | + | 771 | WP_243588917.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15477.06 Da Isoelectric Point: 9.8431
>T269062 WP_272108684.1 NZ_CP116597:887263-887667 [Staphylococcus sp. NRL 22/194]
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYRLDRDSVILLEQIR
TLDKKRLKEKLTYLSEEKMKEVDEALDISLGLHEVRPQKLDYFMYKPNIYLIKR
MIKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYRLDRDSVILLEQIR
TLDKKRLKEKLTYLSEEKMKEVDEALDISLGLHEVRPQKLDYFMYKPNIYLIKR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|