Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 33364..34501 | Replicon | plasmid pK205-4b-A |
Accession | NZ_CP116584 | ||
Organism | Enterococcus dispar strain K205-4b |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PML78_RS13410 | Protein ID | WP_271858591.1 |
Coordinates | 33638..34501 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | PML78_RS13405 | Protein ID | WP_002326825.1 |
Coordinates | 33364..33636 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML78_RS13375 (PML78_13375) | 30375..30542 | + | 168 | Protein_33 | peptide-binding protein | - |
PML78_RS13380 (PML78_13380) | 30665..30748 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
PML78_RS13385 (PML78_13385) | 30873..31610 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PML78_RS13390 (PML78_13390) | 31780..32040 | + | 261 | Protein_36 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
PML78_RS13395 (PML78_13395) | 32143..33039 | + | 897 | WP_014862451.1 | ParA family protein | - |
PML78_RS13400 (PML78_13400) | 33138..33347 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
PML78_RS13405 (PML78_13405) | 33364..33636 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
PML78_RS13410 (PML78_13410) | 33638..34501 | + | 864 | WP_271858591.1 | zeta toxin family protein | Toxin |
PML78_RS13415 (PML78_13415) | 34939..35436 | + | 498 | WP_271858592.1 | molecular chaperone DnaJ | - |
PML78_RS13420 (PML78_13420) | 35470..35775 | + | 306 | WP_271858593.1 | hypothetical protein | - |
PML78_RS13425 (PML78_13425) | 35798..36055 | - | 258 | WP_000002668.1 | hypothetical protein | - |
PML78_RS13430 (PML78_13430) | 36058..36357 | - | 300 | WP_271858595.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | erm(B) | - | 1..38374 | 38374 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32687.33 Da Isoelectric Point: 7.3939
>T269060 WP_271858591.1 NZ_CP116584:33638-34501 [Enterococcus dispar]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKIPKLPGL
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKIPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|