Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2343951..2344558 | Replicon | chromosome |
Accession | NZ_CP116581 | ||
Organism | Enterococcus durans strain R59-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PML98_RS10915 | Protein ID | WP_193808921.1 |
Coordinates | 2343951..2344301 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PML98_RS10920 | Protein ID | WP_081134844.1 |
Coordinates | 2344295..2344558 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML98_RS10895 (PML98_10895) | 2339676..2340491 | - | 816 | WP_113846130.1 | Cof-type HAD-IIB family hydrolase | - |
PML98_RS10900 (PML98_10900) | 2340488..2341177 | - | 690 | WP_005878253.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
PML98_RS10905 (PML98_10905) | 2341804..2342053 | + | 250 | Protein_2144 | TPM domain-containing protein | - |
PML98_RS10910 (PML98_10910) | 2342277..2343752 | + | 1476 | WP_271847677.1 | metallophosphoesterase | - |
PML98_RS10915 (PML98_10915) | 2343951..2344301 | - | 351 | WP_193808921.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML98_RS10920 (PML98_10920) | 2344295..2344558 | - | 264 | WP_081134844.1 | PbsX family transcriptional regulator | Antitoxin |
PML98_RS10925 (PML98_10925) | 2344902..2345576 | - | 675 | WP_226103608.1 | Crp/Fnr family transcriptional regulator | - |
PML98_RS10930 (PML98_10930) | 2345751..2346029 | + | 279 | WP_005878249.1 | hypothetical protein | - |
PML98_RS10935 (PML98_10935) | 2346048..2347235 | + | 1188 | WP_193808922.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13240.26 Da Isoelectric Point: 8.8202
>T269059 WP_193808921.1 NZ_CP116581:c2344301-2343951 [Enterococcus durans]
MVRNPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSKYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRNPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSKYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|