269058

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1810694..1811187 Replicon chromosome
Accession NZ_CP116581
Organism Enterococcus durans strain R59-1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PML98_RS08235 Protein ID WP_123862886.1
Coordinates 1810694..1810960 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2A7SN65
Locus tag PML98_RS08240 Protein ID WP_005880060.1
Coordinates 1810957..1811187 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML98_RS08200 (PML98_08200) 1807116..1807349 - 234 WP_193809572.1 DUF3850 domain-containing protein -
PML98_RS08205 (PML98_08205) 1807371..1807886 - 516 WP_193809573.1 AAA family ATPase -
PML98_RS08210 (PML98_08210) 1807890..1808270 - 381 WP_193809574.1 ASCH domain-containing protein -
PML98_RS08215 (PML98_08215) 1808242..1809291 - 1050 WP_193809575.1 hypothetical protein -
PML98_RS08220 (PML98_08220) 1809409..1809957 - 549 WP_193809576.1 hypothetical protein -
PML98_RS08225 (PML98_08225) 1809954..1810139 - 186 WP_193809584.1 hypothetical protein -
PML98_RS08230 (PML98_08230) 1810144..1810473 - 330 WP_193809586.1 conjugal transfer protein -
PML98_RS08235 (PML98_08235) 1810694..1810960 - 267 WP_123862886.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PML98_RS08240 (PML98_08240) 1810957..1811187 - 231 WP_005880060.1 DUF6290 family protein Antitoxin
PML98_RS08245 (PML98_08245) 1811443..1811550 + 108 WP_005880062.1 putative holin-like toxin -
PML98_RS08250 (PML98_08250) 1811785..1812003 - 219 WP_144776358.1 hypothetical protein -
PML98_RS08255 (PML98_08255) 1812175..1812438 - 264 WP_271852119.1 hypothetical protein -
PML98_RS08260 (PML98_08260) 1812949..1813614 - 666 WP_271847584.1 hypothetical protein -
PML98_RS08265 (PML98_08265) 1814126..1814233 + 108 WP_265586000.1 putative holin-like toxin -
PML98_RS08270 (PML98_08270) 1814451..1814921 - 471 WP_193809579.1 hypothetical protein -
PML98_RS08275 (PML98_08275) 1814924..1815187 - 264 WP_193809587.1 hypothetical protein -
PML98_RS08280 (PML98_08280) 1815421..1815612 - 192 WP_115235839.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10582.20 Da        Isoelectric Point: 10.2694

>T269058 WP_123862886.1 NZ_CP116581:c1810960-1810694 [Enterococcus durans]
VTYRLEFTPEIQKQLRKMDKYQATLIVRWLYQHIDGVDDPRKFGKGLTANRSGQWRYRIGKYRVLVEIEDNQMVVIAIQV
GHRRNVYD

Download         Length: 267 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8850.03 Da        Isoelectric Point: 4.2583

>AT269058 WP_005880060.1 NZ_CP116581:c1811187-1810957 [Enterococcus durans]
MAMITVRVSDAEKEWLSYMAEFYGITLSELLKTYSMEQLEDEYDRQTAEIAHKHWIESGKPTVSMEEILNEFGGLK

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2A7SN65

References