Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2336345..2336952 | Replicon | chromosome |
Accession | NZ_CP116579 | ||
Organism | Enterococcus durans strain R109-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PML92_RS10890 | Protein ID | WP_193808921.1 |
Coordinates | 2336345..2336695 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PML92_RS10895 | Protein ID | WP_081134844.1 |
Coordinates | 2336689..2336952 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML92_RS10870 (PML92_10870) | 2332070..2332885 | - | 816 | WP_113846130.1 | Cof-type HAD-IIB family hydrolase | - |
PML92_RS10875 (PML92_10875) | 2332882..2333571 | - | 690 | WP_005878253.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
PML92_RS10880 (PML92_10880) | 2334198..2334447 | + | 250 | Protein_2139 | TPM domain-containing protein | - |
PML92_RS10885 (PML92_10885) | 2334671..2336146 | + | 1476 | WP_271847677.1 | metallophosphoesterase | - |
PML92_RS10890 (PML92_10890) | 2336345..2336695 | - | 351 | WP_193808921.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML92_RS10895 (PML92_10895) | 2336689..2336952 | - | 264 | WP_081134844.1 | PbsX family transcriptional regulator | Antitoxin |
PML92_RS10900 (PML92_10900) | 2337296..2337970 | - | 675 | WP_226103608.1 | Crp/Fnr family transcriptional regulator | - |
PML92_RS10905 (PML92_10905) | 2338145..2338423 | + | 279 | WP_005878249.1 | hypothetical protein | - |
PML92_RS10910 (PML92_10910) | 2338442..2339629 | + | 1188 | WP_193808922.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13240.26 Da Isoelectric Point: 8.8202
>T269055 WP_193808921.1 NZ_CP116579:c2336695-2336345 [Enterococcus durans]
MVRNPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSKYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRNPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSKYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|