Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1811188..1811681 Replicon chromosome
Accession NZ_CP116579
Organism Enterococcus durans strain R109-1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PML92_RS08245 Protein ID WP_123862886.1
Coordinates 1811188..1811454 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2A7SN65
Locus tag PML92_RS08250 Protein ID WP_005880060.1
Coordinates 1811451..1811681 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML92_RS08210 (PML92_08210) 1807610..1807843 - 234 WP_193809572.1 DUF3850 domain-containing protein -
PML92_RS08215 (PML92_08215) 1807865..1808380 - 516 WP_193809573.1 AAA family ATPase -
PML92_RS08220 (PML92_08220) 1808384..1808764 - 381 WP_193809574.1 ASCH domain-containing protein -
PML92_RS08225 (PML92_08225) 1808736..1809785 - 1050 WP_193809575.1 hypothetical protein -
PML92_RS08230 (PML92_08230) 1809903..1810451 - 549 WP_193809576.1 hypothetical protein -
PML92_RS08235 (PML92_08235) 1810448..1810633 - 186 WP_193809584.1 hypothetical protein -
PML92_RS08240 (PML92_08240) 1810638..1810967 - 330 WP_193809586.1 conjugal transfer protein -
PML92_RS08245 (PML92_08245) 1811188..1811454 - 267 WP_123862886.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PML92_RS08250 (PML92_08250) 1811451..1811681 - 231 WP_005880060.1 DUF6290 family protein Antitoxin
PML92_RS08255 (PML92_08255) 1811937..1812044 + 108 WP_005880062.1 putative holin-like toxin -
PML92_RS08260 (PML92_08260) 1812279..1812497 - 219 WP_144776358.1 hypothetical protein -
PML92_RS08265 (PML92_08265) 1812669..1812932 - 264 WP_271852119.1 hypothetical protein -
PML92_RS08270 (PML92_08270) 1813443..1814108 - 666 WP_271847584.1 hypothetical protein -
PML92_RS08275 (PML92_08275) 1814620..1814727 + 108 WP_265586000.1 putative holin-like toxin -
PML92_RS08280 (PML92_08280) 1814945..1815415 - 471 WP_193809579.1 hypothetical protein -
PML92_RS08285 (PML92_08285) 1815418..1815681 - 264 WP_193809587.1 hypothetical protein -
PML92_RS08290 (PML92_08290) 1815915..1816106 - 192 WP_115235839.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10582.20 Da        Isoelectric Point: 10.2694

>T269054 WP_123862886.1 NZ_CP116579:c1811454-1811188 [Enterococcus durans]
VTYRLEFTPEIQKQLRKMDKYQATLIVRWLYQHIDGVDDPRKFGKGLTANRSGQWRYRIGKYRVLVEIEDNQMVVIAIQV
GHRRNVYD

Download         Length: 267 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8850.03 Da        Isoelectric Point: 4.2583

>AT269054 WP_005880060.1 NZ_CP116579:c1811681-1811451 [Enterococcus durans]
MAMITVRVSDAEKEWLSYMAEFYGITLSELLKTYSMEQLEDEYDRQTAEIAHKHWIESGKPTVSMEEILNEFGGLK

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2A7SN65

References