Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 27115..27649 Replicon plasmid pK205-3-A
Accession NZ_CP116576
Organism Enterococcus faecalis strain K205-3

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag PML83_RS14385 Protein ID WP_002360769.1
Coordinates 27374..27649 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag PML83_RS14380 Protein ID WP_002369771.1
Coordinates 27115..27381 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML83_RS14335 (PML83_14335) 22232..22390 - 159 WP_153246012.1 hypothetical protein -
PML83_RS14340 (PML83_14340) 22519..22929 - 411 WP_271850744.1 hypothetical protein -
PML83_RS14345 (PML83_14345) 23086..23766 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
PML83_RS14350 (PML83_14350) 23863..24003 + 141 WP_236545660.1 hypothetical protein -
PML83_RS14355 (PML83_14355) 24009..24497 + 489 WP_002368088.1 hypothetical protein -
PML83_RS14360 (PML83_14360) 25089..25355 + 267 WP_002368091.1 hypothetical protein -
PML83_RS14365 (PML83_14365) 25388..25882 + 495 WP_002368092.1 DnaJ domain-containing protein -
PML83_RS14370 (PML83_14370) 25980..26396 + 417 WP_002368093.1 single-stranded DNA-binding protein -
PML83_RS14375 (PML83_14375) 26420..27004 + 585 WP_002368095.1 thermonuclease family protein -
PML83_RS14380 (PML83_14380) 27115..27381 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PML83_RS14385 (PML83_14385) 27374..27649 + 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
PML83_RS14390 (PML83_14390) 28452..28637 + 186 WP_002368099.1 hypothetical protein -
PML83_RS14395 (PML83_14395) 28622..28813 + 192 WP_002401572.1 DpnD/PcfM family protein -
PML83_RS14400 (PML83_14400) 29044..29823 + 780 WP_002368102.1 Cas9 inhibitor AcrIIA9 family protein -
PML83_RS14405 (PML83_14405) 29823..31082 + 1260 WP_002368103.1 PcfJ domain-containing protein -
PML83_RS14410 (PML83_14410) 31732..32460 + 729 WP_002368105.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 23080..23766 686
- inside Non-Mobilizable plasmid ant(6)-Ia / aph(3')-III - 1..40660 40660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T269051 WP_002360769.1 NZ_CP116576:27374-27649 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT269051 WP_002369771.1 NZ_CP116576:27115-27381 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References