Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 16243..16939 | Replicon | plasmid pK205-3-A |
Accession | NZ_CP116576 | ||
Organism | Enterococcus faecalis strain K205-3 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A828ZQ58 |
Locus tag | PML83_RS14300 | Protein ID | WP_002334977.1 |
Coordinates | 16517..16939 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL01 |
Locus tag | PML83_RS14295 | Protein ID | WP_002331065.1 |
Coordinates | 16243..16515 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML83_RS14265 (PML83_14265) | 11542..12450 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
PML83_RS14270 (PML83_14270) | 12447..12989 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
PML83_RS14275 (PML83_14275) | 13082..13876 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
PML83_RS14280 (PML83_14280) | 14152..14724 | + | 573 | WP_001079938.1 | HTH domain-containing protein | - |
PML83_RS14285 (PML83_14285) | 15022..15918 | + | 897 | WP_002334978.1 | AAA family ATPase | - |
PML83_RS14290 (PML83_14290) | 16017..16226 | + | 210 | WP_000527318.1 | peptide-binding protein | - |
PML83_RS14295 (PML83_14295) | 16243..16515 | + | 273 | WP_002331065.1 | antitoxin | Antitoxin |
PML83_RS14300 (PML83_14300) | 16517..16939 | + | 423 | WP_002334977.1 | zeta toxin family protein | Toxin |
PML83_RS14305 (PML83_14305) | 16993..17673 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
PML83_RS14310 (PML83_14310) | 17742..17936 | - | 195 | WP_002368123.1 | hypothetical protein | - |
PML83_RS14315 (PML83_14315) | 18172..18495 | + | 324 | WP_002360731.1 | hypothetical protein | - |
PML83_RS14320 (PML83_14320) | 18756..19415 | - | 660 | WP_002368120.1 | hypothetical protein | - |
PML83_RS14325 (PML83_14325) | 19914..20288 | - | 375 | WP_010816301.1 | DUF805 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / aph(3')-III | - | 1..40660 | 40660 | |
- | inside | IScluster/Tn | ant(6)-Ia / aph(3')-III | - | 470..17673 | 17203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15667.64 Da Isoelectric Point: 5.2420
>T269050 WP_002334977.1 NZ_CP116576:16517-16939 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSGSVAKF
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSGSVAKF
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZQ58 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZL55 |