Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2765134..2765705 | Replicon | chromosome |
Accession | NZ_CP116575 | ||
Organism | Enterococcus faecalis strain K205-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | PML83_RS13560 | Protein ID | WP_002360937.1 |
Coordinates | 2765134..2765475 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | PML83_RS13565 | Protein ID | WP_002354773.1 |
Coordinates | 2765475..2765705 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML83_RS13555 (2761149) | 2761149..2764763 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
PML83_RS13560 (2765134) | 2765134..2765475 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML83_RS13565 (2765475) | 2765475..2765705 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
PML83_RS13570 (2766112) | 2766112..2766327 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PML83_RS13575 (2766466) | 2766466..2767458 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PML83_RS13580 (2767722) | 2767722..2768351 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
PML83_RS13585 (2769044) | 2769044..2770660 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T269035 WP_002360937.1 NZ_CP116575:c2765475-2765134 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A812 |