Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1846025..1846719 Replicon chromosome
Accession NZ_CP116575
Organism Enterococcus faecalis strain K205-3

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag PML83_RS09150 Protein ID WP_002378467.1
Coordinates 1846375..1846719 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag PML83_RS09145 Protein ID WP_002392358.1
Coordinates 1846025..1846357 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML83_RS09100 (1841434) 1841434..1841751 - 318 WP_002357007.1 hypothetical protein -
PML83_RS09105 (1841971) 1841971..1842525 + 555 WP_002357006.1 hypothetical protein -
PML83_RS09110 (1842810) 1842810..1843148 - 339 WP_002357003.1 hypothetical protein -
PML83_RS09115 (1843185) 1843185..1843394 - 210 WP_002357002.1 hypothetical protein -
PML83_RS09120 (1843449) 1843449..1843637 + 189 WP_002357001.1 YegP family protein -
PML83_RS09125 (1843663) 1843663..1844388 - 726 WP_010730824.1 ORF6C domain-containing protein -
PML83_RS09130 (1844427) 1844427..1844738 - 312 WP_002381719.1 hypothetical protein -
PML83_RS09135 (1845335) 1845335..1845532 - 198 WP_010712611.1 hypothetical protein -
PML83_RS09140 (1845545) 1845545..1845727 - 183 WP_002358110.1 hypothetical protein -
PML83_RS09145 (1846025) 1846025..1846357 + 333 WP_002392358.1 helix-turn-helix transcriptional regulator Antitoxin
PML83_RS09150 (1846375) 1846375..1846719 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
PML83_RS09155 (1846755) 1846755..1847483 + 729 WP_002378468.1 potassium channel family protein -
PML83_RS09160 (1847583) 1847583..1848731 + 1149 WP_002388210.1 site-specific integrase -
PML83_RS09165 (1848759) 1848759..1849202 - 444 WP_025192396.1 competence type IV pilus minor pilin ComGD -
PML83_RS09170 (1849199) 1849199..1849474 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
PML83_RS09175 (1849474) 1849474..1850520 - 1047 WP_002356990.1 competence type IV pilus assembly protein ComGB -
PML83_RS09180 (1850477) 1850477..1851445 - 969 WP_002364362.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1800004..1849175 49171


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-59)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T269030 WP_002378467.1 NZ_CP116575:1846375-1846719 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12660.01 Da        Isoelectric Point: 4.5116

>AT269030 WP_002392358.1 NZ_CP116575:1846025-1846357 [Enterococcus faecalis]
MNTYEIIKDLAKEKGISIRQLEINFGYSNGYIGSWKRQTPNSNELSRLADYFDVSVDYLLGRTDNTKATDEKKSDDLDDV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References