Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1846025..1846719 | Replicon | chromosome |
| Accession | NZ_CP116575 | ||
| Organism | Enterococcus faecalis strain K205-3 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | S4BLV4 |
| Locus tag | PML83_RS09150 | Protein ID | WP_002378467.1 |
| Coordinates | 1846375..1846719 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | PML83_RS09145 | Protein ID | WP_002392358.1 |
| Coordinates | 1846025..1846357 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML83_RS09100 (1841434) | 1841434..1841751 | - | 318 | WP_002357007.1 | hypothetical protein | - |
| PML83_RS09105 (1841971) | 1841971..1842525 | + | 555 | WP_002357006.1 | hypothetical protein | - |
| PML83_RS09110 (1842810) | 1842810..1843148 | - | 339 | WP_002357003.1 | hypothetical protein | - |
| PML83_RS09115 (1843185) | 1843185..1843394 | - | 210 | WP_002357002.1 | hypothetical protein | - |
| PML83_RS09120 (1843449) | 1843449..1843637 | + | 189 | WP_002357001.1 | YegP family protein | - |
| PML83_RS09125 (1843663) | 1843663..1844388 | - | 726 | WP_010730824.1 | ORF6C domain-containing protein | - |
| PML83_RS09130 (1844427) | 1844427..1844738 | - | 312 | WP_002381719.1 | hypothetical protein | - |
| PML83_RS09135 (1845335) | 1845335..1845532 | - | 198 | WP_010712611.1 | hypothetical protein | - |
| PML83_RS09140 (1845545) | 1845545..1845727 | - | 183 | WP_002358110.1 | hypothetical protein | - |
| PML83_RS09145 (1846025) | 1846025..1846357 | + | 333 | WP_002392358.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PML83_RS09150 (1846375) | 1846375..1846719 | + | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| PML83_RS09155 (1846755) | 1846755..1847483 | + | 729 | WP_002378468.1 | potassium channel family protein | - |
| PML83_RS09160 (1847583) | 1847583..1848731 | + | 1149 | WP_002388210.1 | site-specific integrase | - |
| PML83_RS09165 (1848759) | 1848759..1849202 | - | 444 | WP_025192396.1 | competence type IV pilus minor pilin ComGD | - |
| PML83_RS09170 (1849199) | 1849199..1849474 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| PML83_RS09175 (1849474) | 1849474..1850520 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| PML83_RS09180 (1850477) | 1850477..1851445 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1800004..1849175 | 49171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13712.62 Da Isoelectric Point: 5.5523
>T269030 WP_002378467.1 NZ_CP116575:1846375-1846719 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|