Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 414183..414765 Replicon chromosome
Accession NZ_CP116575
Organism Enterococcus faecalis strain K205-3

Toxin (Protein)


Gene name zeta Uniprot ID A0A0M2AE74
Locus tag PML83_RS02135 Protein ID WP_002355414.1
Coordinates 414457..414765 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag PML83_RS02130 Protein ID WP_002326825.1
Coordinates 414183..414455 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML83_RS02095 (409463) 409463..410191 - 729 WP_002355404.1 GntR family transcriptional regulator -
PML83_RS02100 (410368) 410368..411294 + 927 WP_002355406.1 hypothetical protein -
PML83_RS02105 (411311) 411311..412594 + 1284 WP_002363033.1 PTS sugar transporter subunit IIC -
PML83_RS02110 (412591) 412591..412728 - 138 WP_229209646.1 hypothetical protein -
PML83_RS02115 (412787) 412787..412909 + 123 Protein_393 topoisomerase -
PML83_RS02120 (412984) 412984..413880 + 897 WP_002363034.1 ParA family protein -
PML83_RS02125 (413957) 413957..414166 + 210 WP_002363035.1 peptide-binding protein -
PML83_RS02130 (414183) 414183..414455 + 273 WP_002326825.1 antitoxin Antitoxin
PML83_RS02135 (414457) 414457..414765 + 309 WP_002355414.1 zeta toxin family protein Toxin
PML83_RS02140 (414845) 414845..415267 - 423 WP_080005963.1 tyrosine-type recombinase/integrase -
PML83_RS02145 (415318) 415318..415818 - 501 WP_002363039.1 HAD family hydrolase -
PML83_RS02150 (415823) 415823..416590 - 768 WP_002355416.1 DeoR/GlpR family DNA-binding transcription regulator -
PML83_RS02155 (417078) 417078..417503 + 426 WP_002355418.1 galactose-6-phosphate isomerase subunit LacA -
PML83_RS02160 (417520) 417520..418035 + 516 WP_002345825.1 galactose-6-phosphate isomerase subunit LacB -
PML83_RS02165 (418046) 418046..418978 + 933 WP_002363040.1 tagatose-6-phosphate kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element ClpL bsh / esp / psaA 385707..528325 142618


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(27-99)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11525.91 Da        Isoelectric Point: 5.7251

>T269028 WP_002355414.1 NZ_CP116575:414457-414765 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN

Download         Length: 309 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT269028 WP_002326825.1 NZ_CP116575:414183-414455 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AE74

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References