Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 5450..6587 | Replicon | plasmid pK190-1-B |
| Accession | NZ_CP116573 | ||
| Organism | Enterococcus faecalis strain K190-1 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | PML73_RS14795 | Protein ID | WP_002332783.1 |
| Coordinates | 5724..6587 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | PML73_RS14790 | Protein ID | WP_002326825.1 |
| Coordinates | 5450..5722 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML73_RS14750 (PML73_14750) | 657..1487 | + | 831 | WP_000242080.1 | undecaprenyl-diphosphate phosphatase | - |
| PML73_RS14755 (PML73_14755) | 1684..2364 | - | 681 | WP_000191454.1 | IS6-like element ISEnfa1 family transposase | - |
| PML73_RS14760 (PML73_14760) | 2463..2702 | + | 240 | WP_000635249.1 | peptide-binding protein | - |
| PML73_RS14765 (PML73_14765) | 2751..2834 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| PML73_RS14770 (PML73_14770) | 2959..3696 | + | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| PML73_RS14775 (PML73_14775) | 3866..4126 | + | 261 | Protein_6 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| PML73_RS14780 (PML73_14780) | 4229..5125 | + | 897 | WP_002326827.1 | ParA family protein | - |
| PML73_RS14785 (PML73_14785) | 5217..5432 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
| PML73_RS14790 (PML73_14790) | 5450..5722 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| PML73_RS14795 (PML73_14795) | 5724..6587 | + | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| PML73_RS14800 (PML73_14800) | 7027..7344 | + | 318 | WP_002326830.1 | hypothetical protein | - |
| PML73_RS14805 (PML73_14805) | 7878..8375 | + | 498 | WP_002338758.1 | hypothetical protein | - |
| PML73_RS14810 (PML73_14810) | 8409..8642 | + | 234 | WP_002332654.1 | hypothetical protein | - |
| PML73_RS14815 (PML73_14815) | 8736..8993 | - | 258 | WP_000002668.1 | hypothetical protein | - |
| PML73_RS14820 (PML73_14820) | 8996..9295 | - | 300 | WP_002332653.1 | hypothetical protein | - |
| PML73_RS14825 (PML73_14825) | 9578..11572 | + | 1995 | WP_229205849.1 | MobA/MobL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / aac(6')-aph(2'') | - | 1..38206 | 38206 | |
| - | flank | IS/Tn | erm(B) | - | 1684..3696 | 2012 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T269027 WP_002332783.1 NZ_CP116573:5724-6587 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |