Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 34966..35500 Replicon plasmid pK190-1-A
Accession NZ_CP116572
Organism Enterococcus faecalis strain K190-1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PML73_RS14580 Protein ID WP_048948955.1
Coordinates 35225..35500 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag PML73_RS14575 Protein ID WP_002369771.1
Coordinates 34966..35232 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML73_RS14530 (PML73_14530) 30427..30588 + 162 WP_002399271.1 hypothetical protein -
PML73_RS14535 (PML73_14535) 30585..31370 + 786 WP_002387611.1 replication-relaxation family protein -
PML73_RS14540 (PML73_14540) 31376..31864 + 489 WP_002404733.1 hypothetical protein -
PML73_RS14545 (PML73_14545) 32457..32723 + 267 WP_126266275.1 hypothetical protein -
PML73_RS14550 (PML73_14550) 32756..33256 + 501 WP_002360775.1 DnaJ domain-containing protein -
PML73_RS14555 (PML73_14555) 33393..33518 + 126 WP_229023520.1 DUF3850 domain-containing protein -
PML73_RS14560 (PML73_14560) 33594..34010 + 417 WP_126266276.1 single-stranded DNA-binding protein -
PML73_RS14565 (PML73_14565) 34034..34618 + 585 WP_126266277.1 thermonuclease family protein -
PML73_RS14570 (PML73_14570) 34615..34863 + 249 WP_126266278.1 alpha-glucosidase -
PML73_RS14575 (PML73_14575) 34966..35232 + 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PML73_RS14580 (PML73_14580) 35225..35500 + 276 WP_048948955.1 type II toxin-antitoxin system YafQ family toxin Toxin
PML73_RS14585 (PML73_14585) 36303..36488 + 186 WP_002365983.1 hypothetical protein -
PML73_RS14590 (PML73_14590) 36473..36664 + 192 WP_002399282.1 DpnD/PcfM family protein -
PML73_RS14595 (PML73_14595) 36688..37239 + 552 WP_126263907.1 hypothetical protein -
PML73_RS14600 (PML73_14600) 37374..38153 + 780 WP_126266279.1 Cas9 inhibitor AcrIIA9 family protein -
PML73_RS14605 (PML73_14605) 38153..39496 + 1344 WP_126267491.1 PcfJ domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid optrA / fexA prgB/asc10 1..63994 63994


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-87)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10718.55 Da        Isoelectric Point: 9.6918

>T269026 WP_048948955.1 NZ_CP116572:35225-35500 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKDVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9804.15 Da        Isoelectric Point: 4.4791

>AT269026 WP_002369771.1 NZ_CP116572:34966-35232 [Enterococcus faecalis]
MATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References