269003

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1847172..1847865 Replicon chromosome
Accession NZ_CP116571
Organism Enterococcus faecalis strain K190-1

Toxin (Protein)


Gene name IrrE Uniprot ID S4BLV4
Locus tag PML73_RS09270 Protein ID WP_002378467.1
Coordinates 1847521..1847865 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag PML73_RS09265 Protein ID WP_002364355.1
Coordinates 1847172..1847504 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML73_RS09215 (1842424) 1842424..1843317 - 894 WP_104669585.1 recombinase RecT -
PML73_RS09220 (1843320) 1843320..1844261 - 942 WP_002364219.1 YqaJ viral recombinase family protein -
PML73_RS09225 (1844359) 1844359..1844586 - 228 WP_002364220.1 hypothetical protein -
PML73_RS09230 (1844586) 1844586..1844909 - 324 WP_002369793.1 hypothetical protein -
PML73_RS09235 (1844953) 1844953..1845138 - 186 WP_002364222.1 hypothetical protein -
PML73_RS09240 (1845129) 1845129..1845323 - 195 WP_002364223.1 hypothetical protein -
PML73_RS09245 (1845376) 1845376..1845558 + 183 WP_002364224.1 YegP family protein -
PML73_RS09250 (1845598) 1845598..1846323 - 726 WP_271865370.1 ORF6C domain-containing protein -
PML73_RS09255 (1846362) 1846362..1846673 - 312 WP_002381719.1 hypothetical protein -
PML73_RS09260 (1846684) 1846684..1846860 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
PML73_RS09265 (1847172) 1847172..1847504 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
PML73_RS09270 (1847521) 1847521..1847865 + 345 WP_002378467.1 ImmA/IrrE family metallo-endopeptidase Toxin
PML73_RS09275 (1847901) 1847901..1848629 + 729 WP_002378468.1 potassium channel family protein -
PML73_RS09280 (1848729) 1848729..1849877 + 1149 WP_002378469.1 site-specific integrase -
PML73_RS09285 (1849914) 1849914..1850348 - 435 Protein_1798 competence type IV pilus minor pilin ComGD -
PML73_RS09290 (1850345) 1850345..1850620 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
PML73_RS09295 (1850620) 1850620..1851666 - 1047 WP_002401325.1 competence type IV pilus assembly protein ComGB -
PML73_RS09300 (1851623) 1851623..1852591 - 969 WP_002401324.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(M) efaA 1842328..1904592 62264


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-89)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13712.62 Da        Isoelectric Point: 5.5523

>T269003 WP_002378467.1 NZ_CP116571:1847521-1847865 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYIELYKIPSFRNKMEAEADY
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLN

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT269003 WP_002364355.1 NZ_CP116571:1847172-1847504 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4BLV4

Antitoxin

Source ID Structure

References